Version History MagnetSVN 2.4 (Current stable)Fixed...

New Download Links
Speed
New Download Links
Speed
Category: 

Contents


Version History MagnetSVN 2.4 (Current stable)Fixed... Press button ScientificVersion History MagnetSVN 2.4 (Current stable)Fixed installation issues, enabled show changes in Word. Released on March 18, 2015.Re-enabled show changes feature of Word documentsFixed installation issue. MagnetSVN 2.3Added Excel 2013 support! Released on December 11, 2013.Added Excel 2013 supportAdded project folder to known project list on any operation within itImproved start versioning here menuImproved usability when closing document with non-commited changesBug fixes.To read more about latest changes and improvements in MagnetSVN please go to Release notes 2.2 page. MagnetSVN 2.2Version with Subversion 1.8, Word 2013 and Windows 8 support! Released on November 5, 2013.Subversion1.8 support. Read more in What's New in Subversion 1.8? article.Word 2013 supportWindows 8 supportAbility to update the document to one of its previous versionsAbility to edit collaborative document if repository is unavailable (Begin editing document anyway)Ability to edit document while ‘Show Changes’ window is openAuto Cleanup for locked working copiesOpen revision on double clickHuge UI improvements: reworked most of the warnings and user dialogs and tooltipsImprovements in using of Personal and Collaborative ModesImproved logic of working with collaborative documentsBug fixes. MagnetSVN 1.7Next stable version since 0.7.2 - completely reworked. Released on August 20, 2013.Major Improvements:Simplified and improved installation. Default installation available.Show Word document Changes window opens from Ribbon, sidebar and Resolve Conflict windows.Improved start using workflow.Added ability to checkout working copy both from local and remote repositories.Introduced Collaborative mode preventing document from conflicting edits.Added non-intrusive notifications.Added user interface compatibility with Windows 7. Most dialogs look modern both in Windows 7 and Windows XP.and lots more! MagnetSVN 1.0.5 BetaVersion with new bugfixes and usability improvements. Released on April 8, 2013. MagnetSVN 1.0.3 BetaVersion with lots of bugfixes - works as stable with minor issues. Released on March 27, 2013. MagnetSVN 1.0.2 BetaVersion with major improvements - totally reworked interface. Released on February 2, 2013.Find an actual list of changes in Beta version MagnetSVN Beta MagnetSVN 0.7.2 (Supported Minimalistic Prototype)Download MagnetSVN 0.7.2 (32-bit)Download MagnetSVN 0.7.2 (64-bit)Version with Subversion 1.7 support and some other improvements. Released on November 18, 2011.Major Improvements:Added: Subversion 1.7 support with older format working copy upgrade. See our article on what’s new in Subversion 1.7.Critical Fix: On some computers with different locales in Windows and Microsoft Office Excel may crash.Fix: On localized version of Microsoft Excel a dialog window may appear on every MagnetSVN operation: “Conflict with name, name must not be the same as the internal name. Old Name: _FilterDatabase”.Added What's New in Subversion 1.7 article. MagnetSVN 0.7.1 BetaVersion with lots of critical fixes and improvements. Released on October 21, 2011.Major Improvements:Added: Ability to copy or move a document outside the versioned folder to the My Versioned Documents folder on Commit.Removed notification Document has been changed. Proceed with commit before close because it was too annoying especially for those users who use Excel documents with macros modifying the document on every opening.Removed support for Word template documents (dotx) because of poor support in source code. Will be added later with Excel template support.Fixed: Only error messages are written to the log file by default. MSVN_MINLOGLEVEL environment variable can be set to write more information to the log. Values: 0-everything 1-information messages, warnings and errors 2-warnings and errors 3-errors only (by default). Repeating messages are written to the log not more often than once an hour.Fixed: MagnetSVN temporary files (~~*.*) are deleted on document closing.Fixed commit error when adding subdirectory that contains missing files.Fixed Null Reference Exception when executing MagnetSVN commands on the document that is in protected mode in Microsoft Excel 2010.Fixed default Commit text. No more (enter your comments here) records in the log.Improved Steal Lock, Break Lock confirmation windows and resulting messages. Now you can just retry getting lock instead of stealing it.Fixed: Possible Null Reference Exception.Fixed Word / Excel crash on invalid link click in the notification window.Minor Improvements:Improved design of notification forms.Fixed formatting of the Details dialog contents.Fixed path formatting in dialogs.Improved button text on the Release Lock before Close notification window.Performed some other minor fixes. MagnetSVN 0.7.0 BetaVersion with most wanted features added and lots of fixes. Released on August 3, 2011.New Features:MOST WANTED! Automatic adding subdirectories under Subversion control within working copy (on document commit).'Update document folder' command.'Modified' status displaying.New progress window with status notifications, 'Open folder' button and 'Details' window.Improvements:Fixed: 'Null Reference' error on Word / Excel startup.Fixed: Incorrect 'Cleanup' behavior when document was added but not commited to Subversion.Fixed: Error when opening document by URL. Show 'Not supported' on every MagnetSVN button press instead.Fixed: When executing 'Open revision...' command from 'Log' window document change history now processed correctly.Fixed: 'Open revision...' command can be cancelled now.Improved files layout in installation folder. Binaries (and log file) are in Bin subfolder, documents - in Docs.Improved user experience on read-only documents.Performed a lot of other minor improvements.Website Changes:Added Google's '+1' button for you to vote for our site. MagnetSVN 0.6.1 BetaVersion with critical fixes. Released on June 16, 2011.Improvements:CRITICAL! Fixed Excel shutdown to prevent disappearing of MagnetSVN ribbon tab during next run.MAJOR. Fixed Error 'Unexpected open document' when use Excel shared workbook.Fixed error when saving read-only document with different name in Word.Fixed update for read-only document with unsaved changes. Update will work now after discarding these changes.Prevented Resolve conflict window from endless reappearing.Improved error and warning messages when locking failed and cannot write to repository.Website Changes:Dramatically decreased load time for the most pages. MagnetSVN 0.6 BetaVersion with Subversion locking support, show log and retrieve past version features, document status and more. Released on May 25, 2011.New Features:Added Subversion locking support: getting (releasing) lock, setting (resetting) Needs-lock property to force document opening in read-only mode.Added showing log of modification messages for past revisions with ability to download any past revision.Added document status display on the ribbon. Supported statuses so far: unversioned, versioned, properties modified, locked, conflicted, needs cleanup, unsupported, unknown, no document.Added SVN+SSH protocol support.Improvements:Improved logging.Improved text of some notifications.Added confirmation to release lock / commit changes in document before closing it.Fixed “Invalid handle” window handle-related errors, optimized Microsoft Office Word and Excel window handle search.Early Access Program:We continued Early Access Program to supply beta testers with new features as early as possible on our site: MagnetSVN EAP MagnetSVN 0.5 BetaVersion with Excel integration. Released on April 4, 2011.New Features:Added Microsoft Excel 2007 and Excel 2010 integration.Added some user manuals ( Start Using Subversion for Documents Versioning with MagnetSVN,Resolving Subversion Conflicts In Microsoft Office Documents with MagnetSVN).New Installation Requirements:System should have Microsoft .Net Framework 2.0 Service Pack 1 installed.Improvements:Improved resolve conflicts window. MagnetSVN 0.4 BetaVersion with major improvements and fixes. Added support of Microsoft Office 64-bit. Removed VSTO library from installation to boost MagnetSVN loading during Word startup. Free evaluation update has been discontinued. Released on February 25, 2011.New Features:Added Microsoft Office 2010 64-bit support.Added silent mode installation support.Improvements:Critical fix: Updated SharpSVN library to fix MagnetSVN freezing when working with VisualSVN Server.Fixed: My Versioned Documents shortcut points to right place after repair or reinstall.Removed Visual Studio Tools for Office from installation.Installation package changed its format to more secure MSI.StartUsing document got internet repository setup description.About window got information about free updates period and versions.After uninstallation MagnetSVN feedback page opens.Improved logging and error handling.Removed Features:Free evaluation update has been discontinued.Installation for All users is no longer supported. MagnetSVN 0.3.2 BetaVersion with installation improvements and some fixes. Released on January 22, 2011.Improvements:Improved: enabled one-click default installation and update of MagnetSVN package.Fixed: document zoom restores after reload. MagnetSVN 0.3.1 BetaVersion with a single critical fix after 0.3.0. Released on December 23, 2010.Improvements:Fixed: when two documents are open, updating or reverting one of them may cause loss of formatting in another. MagnetSVN 0.3 BetaVersion with multi-document and license key support. Released on December 18, 2010.New Features:Added support of working with multiple open documents. Before 0.3 MagnetSVN could only work with a single opened Office DocumentImplemented license key support in MagnetSVN key folder lock vn-zoom. It means that there is no need to wait and download licensed version after purchase anymore. Now you will get your license key soon after purchase: just register it in the installed MagnetSVN copy and use it!Improvements:Improved website, added new content: Disabled Copy Link command for local repositories, because there is no reason to use itImproved error handling, fixed text of the messagesEvaluation period now starts on the first run of Microsoft Word after MagnetSVN installation and lasts for 30 days. MagnetSVN 0.2.5 BetaVersion with slight improvements. Released on December 12, 2010.Improvements:Fixed MagnetSVN buy page SSL issue: there is no more browser warnings Fixed Installation: do not allow installation when choose option “Do not install Visual Studio Tools for Office (VSTO)”Updated evaluation license up to January 31, 2011. MagnetSVN 0.2.4 BetaVersion with Office 2010 experimental support. Released on October 21, 2010.New Features:Added experimental Word 2010 integration (in Office 32bit only). Temporary turned off Smart document reload feature to prevent Word hanging after completing MagnetSVN operations.Improvements:Fixed “My Versioned Documents” folder location for All Users installation.Set up access rights for “My Versioned Documents” and Documents Repository folders.Updated evaluation license up to December 25, 2010. MagnetSVN 0.2.3 BetaVersion with critical bugfixes and improvements. Released on October 03, 2010.Critical Bugfixes:More fixes in CAS policy setting during installation: MagnetSVN works again.Bugfixes:Fixed access rights checking in installation folderFixed: Error during checkout dialog shows twiceFixed: VSTO prompts to install even if Microsoft Office is not installedFixed: Copy Link puts in buffer link to previously open document if it was saved to unsupported format.Improvements:Added My Versioned Documents shortcut to Start|Programs|MagnetSVN menuAdded Version History document to the installation package (available) in Start|Programs|MagnetSVN menuChanged installation path for non-administrative user from AppDataRoaming to AppDataLocalFixed ugly MagnetSVN: uncommented default message. Now it is Document has been changed.Updated evaluation license up to November 15, 2010. MagnetSVN 0.2.2 BetaVersion with some bugfixes and improvements. Released on September 20, 2010.Improvements:Added additional loggingUpdated evaluation license up to October 31, 2010.Bugfixes:Fixed installation text and some headersFixed bug with CAS policy setting during installation. MagnetSVN 0.2.1 BetaVersion with minor improvements . Released on August 26, 2010.Improvements:GUI: Improved ribbon layoutUpdated evaluation license up to October 10, 2010. MagnetSVN 0.2 BetaThe first MagnetSVN version available for download without registration on the website. Released on August 10, 2010.New Features:GUI: Added Cancel button to interrupt Subversion operations from progress dialog.Improvements:GUI: Redesigned resolve conflicts windowApplied several other minor improvements. MagnetSVN 0.1 EAPThe first MagnetSVN version publically available via Early Access Program. Released on June 15, 2010.Main Features:Microsoft Office Word 2007 ribbon interface integrationSubversion commands execution on open documentLocal Subversion repository creationWorking copy creation for local or remote repositorySmart document reloading after Subversion commands.

Bộ cài XPSP3 Integrated update 4/9/2013 .


*i*m*g*KB892130 - Windows Genuine Advantage Validation Tool ActiveX Control 1.9.42.0KB898461 - Permanent copy of the Package Installer for Windows version 6.3.13.0KB909520 - Software update for Base Smart Card Cryptographic Service ProviderKB916157 - When you receive a Stop error message or a fatal system error message, a user-mode process dump file is not created in Windows XPKB922120 - Network Map in Windows Vista does not display computers that are running Windows XPKB931125 - Microsoft Root Certificates Update (December 2012)KB932578 - Event ID 55 may be logged in the System log when creating many files on an NTFS partitionKB932716 - Image Mastering API v2.0 (IMAPIv2.0) update package that is dated June 26, 2007 (cdrom.sys)KB942213 - The MMC.exe program randomly becomes unresponsive when the user clicks OK or Cancel several times to close a Windows formKB942288 - Windows Installer 4.5KB943232 - An application that uses Sxs.dll crashes when running the applicationKB944043 - Windows Server 2008 read-only domain controller compatibility packKB946648 - Security update for Windows Messenger 4.7KB947460 - : is not accessible error when trying to open a mapped DFS folder after coming out of standbyKB948046 - A Word document is not printed as expected after installing the Windows European Union Expansion Font packKB948101 - USB keyboard does not work after restarting a computer that has an NVIDIA 680i motherboardKB948720 - Cannot install device drivers in a Windows Server 2008 cluster environment if the drivers contain LZ-compressed filesKB949127 - Cannot establish a wireless connection using EAP authentication if the Service Set Identifier (SSID) includes a commaKB949764 - A USB device no longer works after resuming computer from hibernation (S4)KB949900 - The RunOnce.exe process may stop responding during the driver installation processKB950616 - An audio application that uses the Portcls.sys file may stop respondingKB950974 - Vulnerability in Event System could allow remote code executionKB951126 - Multiprocessor computer stops responding on a black screen after resuming from hibernationKB951376 - Vulnerability in Bluetooth stack could allow remote code executionKB951531 - The W32Time service does not synchronize the CMOS clock time to the Internet time after the W32Time service stopsKB951608 - Update for Credential Security Support Provider (CredSSP) in Windows XP Service Pack 3KB951618 - A black screen occurs when upgrading the operating system on a computer that has Onekey Recovery 5.0 installedKB951624 - A 30-second delay occurs during the initialization of some network-based applicationsKB951709 - Event ID 26 when attaching two IDE ATA/ATAPI devices as master and subordinate IDE devicesKB951978 - Script output is not displayed as expected when running VBScript or JScript scriptsKB952004 - Description of the security update for MSDTC Transaction Facility (April 2009)KB952011 - Image Mastering API v2.0 (IMAPIv2.0) update package in Windows Feature Pack for Storage 1.0KB952069 - Security update for Windows Media Format Runtime and Media FoundationKB952954 - Vulnerabilities in Microsoft Windows Image Color Management could allow remote code executionKB953024 - Rich Text Format (.rtf) files may not print correctly when using an application that uses the RichEdit controlKB953028 - An application experiences an access violation and then crashes if the computer has more than four cores or more than four logical processorsKB953155 - Vulnerability in Windows Internet Printing service could allow remote code executionKB953609 - At least one of your changes was not applied successfully to the wireless configuration error when adding a wireless networkKB953761 - Some DHCP Options are not recognized when the DHCP server offer includes option 43KB954155 - Vulnerabilities in Windows Media Runtime Could Allow Remote Code Execution (Windows Media Audio Voice Decoder)KB954193 - Jet 4.0 Database Engine cumulative hotfix package: July 2, 2008KB954232 - On-Screen Keyboard behavior does not mimic the physical keyboard behavior in certain scenariosKB954708 - Update to add support for the serialization of complex Extensible Metadata Platform (XMP) data types in the Windows Imaging ComponentKB954920 - Various error messages when an application requests a result set from new SQL Server 2008 collationsKB955069 - Security update for XML Core Services 3.0KB955109 - 0xC0000005 (Access Violation) error when running an application that uses the Application Desktop Toolbar (AppBar) componentKB955356 - When trying to start a computer that is connected to an IEEE1394 hard disk, it stops responding before the logon screen appearsKB955417 - Protected storage (PStore) uses a lower-quality cryptographic function when the system locale is set to French (France)KB955567 - Data corruption may occur when trying to append data to a FILESTREAM varbinary (max) column in SQL Server 2008KB955576 - TAPI-based applications stop responding, and you cannot disconnect telephone calls on a Windows XP-based telephony serverKB955704 - Support for the exFAT file system formatKB955830 - When you connect to a Windows XP-based computer by using a remote desktop connection, the computer may be not able to automatically enter the Sleep mode again after you log off the computerKB955988 - The Win32_Environment WMI class doesn't return the value of the PATH environment variable if it contains more than 1,024 charactersKB956048 - An application that calls the Image Color Management (ICM) functions in the Icm32.dll module may crashKB956072 - Terminal server does not allow RDP connections whose encryption level is set to LowKB956391 - Cumulative security update for ActiveX (October, 2008)KB956572 - Description of the security update for Windows Service Isolation (April 2009)KB956802 - Vulnerabilities in GDI could allow remote code executionKB956844 - Vulnerability in DHTML Editing Component ActiveX Control Could Allow Remote Code ExecutionKB957931 - A Windows XP-based computer does not respond to 802.1X authentication requests for 20 minutes after a failed authenticationKB958149 - Performance decreases when streaming isochronous data on a computer that has a TI IEEE1394 host controllerKB958244 - System may stop responding when restarting a multicore computerKB958347 - Device that is connected through a 1394 FireWire hub is still present in system after hot unplugging itKB958644 - Vulnerability in Server service could allow remote code executionKB958690 - Vulnerabilities in Windows Kernel Could Allow Remote Code ExecutionKB958817 - Automatic Update window may stop responding when using a WSUS server to deploy updatesKB959267 - After repeatedly docking and undocking a portable computer, unable to change state of attached network deviceKB959334 - Text that has the font set to Arial Black and the font style set to bold may change so that the font style is set to italic opening the documentKB959439 - After uploading encrypted files to a WebDAV share, the files remain encryptedKB959465 - Write protection does not always work on SD memory cardsKB960071 - An access violation occurs when using an application that calls the SQLExecDirect function of the SQL Server ODBC driver to run a long queryKB960380 - A hyperlink control that is used to open a file or an e-mail message fails in an application that uses MSXML 6.0KB960417 - When running an application that uses the SystemTimeToTzSpecificLocalTime function, performance is very poorKB960680 - Update the Slovak koruna currency symbol (Sk) to the Euro (€) the Turkish currency symbol from Yeni Türk Lirasi (YTL) to Türk Lirasi (TL)KB960859 - Vulnerability in Telnet Could Allow Remote Code ExecutionKB961118 - All PCL inbox printer drivers become unsigned after you install the Microsoft .NET Framework 3.5 SP1KB961187 - If you reconnect a removable storage device to a computer running Windows XP, the OS cannot find the removable storage deviceKB961451 - Receive an incorrect value when you query the last-inserted identity value after you use a client-side cursor to insert data to a table that contains an identity column in an application that uses ActiveX Data ObjectsKB961503 - You cannot input characters as expected by using a non-English Input Method Editor in Windows Live MessengerKB961605 - Vulnerabilities in Pragmatic General Multicast (PGM) could allow denial of serviceKB961742 - Update for Windows XP SP3 to enable RemoteApp™KB967048 - Error message on a Windows XP-based computer that has a USB card reader: Stop 0x000000D1KB967756 - Update for Windows Installer 4.5KB968389 - Update to help strengthen authentication credentials in specific scenariosKB968537 - Vulnerabilities in Windows Kernel Could Allow Elevation of PrivilegeKB969059 - Vulnerability in Indexing Service Could Allow Remote Code ExecutionKB969084 - Remote Desktop Connection 7.0 client update for Remote Desktop Services (RDS) for Windows XP SP3KB969238 - A data transfer is corrupted when you transfer data from or to a USB device on a computer that is running Windows XPKB969557 - When you use the Windows Key+L keyboard sequence to lock a Windows XP-based computer shortly after you log on to the system, the operating system may be automatically unlocked and the desktop can be accessedKB970254 - The modem does not work and you cannot open the Network Connections window after you unplug and plug in the modem several times when a PPP connection is established in Windows XPKB970430 - Update that implements Extended Protection for Authentication in the HTTP Protocol Stack (http.sys)KB970483 - Vulnerabilities in Internet Information Services (IIS) could allow elevation of privilegeKB970553 - Error message when you query Win32_Product class after you install applications by using Microsoft Windows Installer (MSI) 4.5 with Per-User option in Windows XP: 0x80041001 - Generic failureKB971029 - Update to restrict AutoRun entries in the AutoPlay dialog to only CD and DVD drivesKB971165 - The CLIENTNAME environment variable returns the value Console instead of the actual client name when users first log on to a Windows XP SP3-based computer by using Remote Desktop ConnectionKB971234 - The Defrag.exe tool crashes when you run the Dfrgntfs.exe tool to defragment a hard disk on a computer that is running Windows XPKB971314 - All PCL inbox printer drivers become unsigned after you install the Microsoft .NET Framework 3.5 SP1 or the XPS Essentials Pack in Windows XPKB971345 - The LimitProfileSize Group Policy setting does not take effect when the size of a user profile is larger than 4 GB on a Windows XP-based client computerKB971657 - Vulnerability in Workstation Service Could Allow Elevation of PrivilegeKB972270 - Vulnerability in the Embedded OpenType Font Engine could allow remote code executionKB972422 - A Windows XP-based computer stops responding at the Windows is loading your profile screen when you connect to the computer by using an RDP connectionKB972435 - Slow performance when you try to open a redirected drive on a remote computer through a Terminal Services sessionKB972878 - The Guaranteed service type Group Policy setting returns to the default value after you restart a client computer that is running Windows XPKB973502 - Credential Roaming service update for Windows XPKB973507 - Security update for the Active Template LibraryKB973540 - Security update for Windows Media Player 9KB973624 - After you use a smart card to log on to a computer that is running Windows XP, Digest authentication failsKB973687 - When an application uses MSXML to process XHTML, redundant retrieval requests for well-known DTD files from the W3C Web server cause XHTML parsing to failKB973815 - Security update for Microsoft MSWebDVD ActiveX ControlKB973869 - Security update for Microsoft DHTML Editing Component ActiveX ControlKB973904 - Vulnerability in WordPad and Office Text Converters Could Allow Remote Code ExecutionKB974112 - Vulnerability in Windows Media Player Could Allow Remote Code ExecutionKB974266 - Group Policy Preferences Client-Side Extension Hotfix RollupKB974318 - Vulnerabilities in Internet Authentication Service Could Allow Remote Code ExecutionKB974392 - Vulnerability in the Local Security Authority Subsystem service could allow denial of serviceKB974571 - Vulnerabilities in Windows CryptoAPI Could Allow SpoofingKB975025 - Security update for Audio Compression Manager: October 13, 2009KB975467 - Vulnerability in Local Security Authority Subsystem Service Could Allow Denial of ServiceKB975558 - Vulnerability in MPEG-4 Codec Could Allow Remote Code ExecutionKB975560 - Vulnerability in Microsoft DirectShow Could Allow Remote Code ExecutionKB975561 - Vulnerability in Windows Movie Maker Could Allow Remote Code ExecutionKB975713 - Vulnerability in Windows Shell Handler could allow remote code executionKB975791 - Update to Notepad.exe in Windows XPKB976002 - Browser Choice update is available in the European Economic AreaKB976323 - Vulnerabilities in Microsoft Exchange and Windows SMTP Service Could Allow Denial of ServiceKB977816 - Vulnerability in Microsoft MPEG Layer-3 Codecs Could Allow Remote Code ExecutionKB977914 - Vulnerability in Microsoft AVI filter Could Allow Remote Code ExecutionKB978338 - Vulnerabilities in Windows ISATAP Component Could Allow SpoofingKB978542 - Vulnerability in Outlook Express and Windows Mail Could Allow Remote Code ExecutionKB978706 - Vulnerability in Microsoft Paint could allow remote code executionKB978695 - Security Update for Windows Media Format Runtime 9 for Windows XP SP3KB978835 - Service cannot access the namespace in Windows XPKB979099 - Rights Management Services Client with Service Pack 2 for Windows XPKB979309 - Vulnerabilities in Windows Authenticode Verification that could allow remote code executionKB979482 - Vulnerabilities in Media Decompression Could Allow Remote Code ExecutionKB979687 - Vulnerability in COM Validation in Windows Shell and WordPad Could Allow Remote Code ExecutionKB981073 - FTP clients may not connect correctly to an FTP site that is hosted in IIS 5.0 or IIS 5.1KB981322 - Vulnerability in Unicode Scripts Processor Could Allow Remote Code ExecutionKB981997 - Vulnerability in Windows Movie Maker Could Allow Remote Code ExecutionKB982132 - Vulnerability in the Embedded OpenType Font Engine Could Allow Remote Code ExecutionKB982316 - Permissions Update for Windows XP TelephonyKB982665 - Vulnerability in Cinepak Codec Could Allow Remote Code ExecutionKB983234 - Update visual Basic Virtual Machine (MSVBVM60.DLL)KB2115168 - Vulnerability in Microsoft MPEG Layer-3 Codecs Could Allow Remote Code ExecutionKB2124261 - Vulnerabilities in Microsoft Internet Information Services (IIS) ASP Could Allow Remote Code ExecutionKB2229593 - Vulnerability in Help and Support Center Could Allow Remote Code ExecutionKB2264107 - This update helps protect against DLL preloading vulnerabilities in software applications on the Windows platformKB2270406 - 0x000000D1 Stop error message when you try to refresh a webpage in Internet Explorer on a computer that is running Windows XP SP3KB2290570 - Vulnerabilities in Microsoft Internet Information Services (IIS) Authentication Could Allow Remote Code ExecutionKB2296011 - Vulnerability in Windows Common Control Library Could Allow Remote Code ExecutionKB2345886 - Update that implements Extended Protection for Authentication in the Server serviceKB2347290 - Vulnerability in Print Spooler Service Could Allow Remote Code ExecutionKB2360937 - Vulnerability in Windows Local Procedure Call Could Cause Elevation of PrivilegeKB2378111 - Vulnerability in Windows Media Player Could Allow Remote Code ExecutionKB2387149 - Vulnerability in Microsoft Foundation Classes Could Allow Remote Code ExecutionKB2393802 - Vulnerability in Windows Kernel could allow elevation of privilegeKB2419632 - Vulnerabilities in Microsoft Data Access Components Could Allow Remote Code ExecutionKB2423089 - Vulnerability in Windows Address Book Could Allow Remote Code ExecutionKB2440591 - Vulnerability in Routing and Remote Access Could Allow Elevation of PrivilegeKB2443105 - Insecure Library Loading in Internet Connection Signup Wizard Could Allow Remote Code ExecutionKB2454533 - Description of a shared folder that is mapped to a network drive is not displayed on a Windows XP SP3-based computerKB2478960 - Vulnerability in Local Security Authority Subsystem Service Could Allow Local Elevation of PrivilegeKB2478971 - Vulnerabilities in Kerberos Could Allow Elevation of PrivilegeKB2479943 - Vulnerabilities in Windows Media Could Allow Remote Code ExecutionKB2483185 - Vulnerability in Windows Shell Graphics Processing Could Allow Remote Code ExecutionKB2485663 - Vulnerability in WordPad Text Converters Could Allow Remote Code ExecutionKB2491683 - Vulnerability in Windows Faxcover Editor Component Could Allow Remote Code ExecutionKB2492386 - Application Compatibility Update for Windows XPKB2498072 - Vulnerability in SCSI driverKB2508429 - Vulnerability in SMB Server Could Allow Remote Code ExecutionKB2509553 - Vulnerability in DNS Resolution Could Allow Remote Code ExecutionKB2510581 - Vulnerability in JScript and VBScript v5.7 Scripting Engines Could Allow Remote Code ExecutionKB2524375 - Fraudulent Digital Certificates could allow spoofingKB2535512 - Vulnerabilities in Distributed File System Could Allow Remote Code ExecutionKB2536276 - Vulnerabilities in SMB Client could allow remote code executionKB2544893 - Vulnerability in MHTML Could Allow Information DisclosureKB2564958 - Security Update for Active Accessibility in WindowsKB2566454 - Vulnerability in Remote Access Service NDISTAPI Driver Could Allow Elevation of PrivilegeKB2570947 - Vulnerability in Windows Components Could Allow Remote Code ExecutionKB2584146 - Vulnerability in Microsoft Windows Could Allow Remote Code ExecutionKB2584577 - Vulnerability in Windows MFC Components Could Allow Remote Code ExecutionKB2585542 - Vulnerability in SSL/TLS Could Allow Information DisclosureKB2592799 - Vulnerability in Ancillary Function Driver Could Allow Elevation of PrivilegeKB2598479 - Vulnerabilities in Windows Media Could Allow Remote Code ExecutionKB2603381 - Vulnerability in Windows Object Packager Could Allow Remote Code ExecutionKB2607712 - Fraudulent Digital Certificates could allow spoofingKB2619339 - Vulnerability in Windows Media Could Allow Remote Code ExecutionKB2620712 - Vulnerability in Windows Client/Server Runtime Subsystem Could Allow Elevation of PrivilegeKB2624667 - Vulnerability in OLE Could Allow Remote Code ExecutionKB2629462 - Computer can become unstable or crashKB2631813 - Vulnerabilities in Windows Media Could Allow Remote Code ExecutionKB2642020 - Print jobs initiated in a Windows XP point and print environment may have missing charactersKB2646524 - Vulnerability in Windows Client/Server Run-time Subsystem Could Allow Elevation of PrivilegeKB2653956 - Vulnerability in Windows Could Allow Remote Code ExecutionKB2655992 - Vulnerability in TLS Could Allow Information DisclosureKB2659262 - Vulnerability in GDI+ Could Allow Remote Code ExecutionKB2661254 - Unauthorized Digital Certificates Could Allow SpoofingKB2661637 - Vulnerability in Indeo Codec Could Allow Remote Code ExecutionKB2686509 - Security Update Enables Fixes to a Problem that can Occur with the Loading of Keyboard Layout FilesKB2691442 - Vulnerability in Windows Shell Could Allow Remote Code ExecutionKB2698365 - Vulnerability in Microsoft Data Access Components Could Allow Remote Code ExecutionKB2705219 - Vulnerabilities in Windows Networking Components Could Allow Remote Code ExecutionKB2712808 - Vulnerabilities in Windows Networking Components Could Allow Remote Code ExecutionKB2719985 - Vulnerability in Microsoft XML Core Services 3.0 6.0 Could Allow Remote Code ExecutionKB2723135 - Vulnerability in Remote Desktop Could Allow Remote Code ExecutionKB2727528 - Vulnerabilities in Windows Shell Could Allow Remote Code ExecutionKB2736233 - Cumulative Security Update for ActiveX Killbits for Windows XPKB2749655 - Update to resolve issues in WindowsKB2753842 - Vulnerability in the OpenType Compact Font Format (CFF) Driver Could Allow Remote Code ExecutionKB2757638 - Vulnerabilities in Microsoft XML Core Services 6.0 Could Allow Remote Code ExecutionKB2758694 - Vulnerabilities in Microsoft XML Core Services 4.0 Could Allow Remote Code ExecutionKB2758857 - Vulnerability in Windows File Handling Component Could Allow Remote Code ExecutionKB2770660 - Vulnerability in DirectPlay Could Allow Remote Code ExecutionKB2780091 - Vulnerability in Media Decompression Could Allow Remote Code ExecutionKB2793313 - Security guidance for NTLMv1 and LM network authenticationKB2798897 - Windows Revoked Roots Certificates UpdateKB2797052 - Vulnerability in Vector Markup Language Could Allow Remote Code ExecutionKB2802968 - Vulnerability in OLE Automation Could Allow Remote Code ExecutionKB2807986 - Vulnerabilities in Kernel-Mode Drivers Could Allow Elevation Of PrivilegeKB2808735 - Vulnerabilities in Kernel-Mode Driver Could Allow Elevation Of PrivilegeKB2813170 - Vulnerabilities in Windows Kernel Could Allow Elevation of PrivilegeKB2813347 - Vulnerability in Remote Desktop Client Could Allow Remote Code ExecutionKB2817183 - Cumulative Security Update for Internet Explorer 6KB2820917 - Vulnerability in Windows Client/Server Run-time Subsystem (CSRSS) Could Allow Elevation of PrivilegeKB2829069 - Cumulative Time Zone UpdateOther UpdatesAdobe Flash Player 11.7.700.169 ActiveX ControlCode65536 FontReg 2.1.3Code65536 ResetWMI 1.3.3Microsoft CAPICOM 2.1.0.2Microsoft European Union Expansion Font Update 1.2Microsoft Qfecheck 6.2.29.0Microsoft Windows Update Web Control 7.6.7600.257Microsoft Update Catalog Web Control 7.4.7057.249Microsoft Update Web Control 7.6.7600.257Microsoft Visual Basic Runtimes 1,2,3,4Microsoft Visual C Runtimes 1,7MSXML 4.0 SP3 4.30.2114.0Miscellaneous TweaksKB873374 - Microsoft GDI+ Detection Tool Registry EntryKB890830 - Microsoft Malicious Software Removal Tool v4.19KB905474 - Windows Genuine Advantage Notifications (Supressed MU Nag to Install)

File Explorer .


Version History MagnetSVN 2.4 (Current stable)Fixed... Allow Remote CodeFX File Explorer version 4.0 is now available with a new Material Design UI!FX File Explorer is a file manager with optional media, networking, cloud, and root capabilities. FX is designed to let you quickly and easily manage all content on your phone or tablet.FX has no ads.The free main module of FX File Explorer (this product) includes all file management features for working with files on your phone/tablet.The FX Plus add-on adds media management, network (FTP, SFTP, SMB, WebDAV) and cloud capabilities (Dropbox, Google Drive, SkyDrive, Box, SugarSync). The Plus add-on is a paid app (with a 7-day free trial).The free FX Root add-on is for developers and knowledgeable enthusiasts who need to make changes as the root user.General Features (included standard):* Material Design.* Productivity-oriented layout: The Home Screen shows bookmarks, storage, tools and (with FX+) media/network locations.

You no longer have to wade through the garbage that apps store in the root folder of your SD card to get to the places you actually use.* Dual pane mode and unlimited windows (quickly switch between different locations)* Pinch-to-zoom in any Explorer window, zoom-in to see additional information about items* Intuitive swipe-to-select gesture for managing multiple items (Slide finger horizontally across items to select/deselect them see YouTube Videos, web site documentation, or in-app help for more information)* Usage View mode analyzes storage space usage, enabling you to see total size of any folder* Indexed SearchFile Viewers / Editors (included standard)* Text Editor with Undo/Redo history, Cut/Copy/Paste, Find, and Pinch-to-zoom* Binary (Hex) Viewer* Image Viewer* Media Player, pop-up Audio Player* Zip, Tar, GZip, Bzip2, and 7zip Archive Extractor / Creator (.zip, .tgz, .tar.gz, .tar.bz2, .7z)* RAR Extractor (UnRAR)* Shell Script ExecutorMedia Capabilities (FX Plus add-on required):* Browse image and video collections* Browse audio by artist, album, playlist, or all tracks* Create and rearrange playlists with drag and drop (multiple files can be rearranged by selecting them)Network / Cloud Capabilities (requires FX Plus add-on):* Windows networking (SMB)* FTP (including secure FTP-S and FTP-ES)* SSH FTP (Secure Shell FTP password and public key auth)* WebDAV (see help for using WebDAV with OwnCloud)* Cloud Storage: Google Drive (incl. Google Docs), Dropbox, SugarSync, Box (Box.net), and SkyDrive (SkyDrive requires Android 2.2 or later)* Stream video and audio media files from SMB, FTP, SSH, Google Drive, Dropbox, SugarSync, Box, and SkyDrive to media player applications* Browse local network for Windows (SMB) shares* Find FTP and SSH FTP local network shares using multicast DNS (mDNS) service discovery (Bonjour/Zeroconf/Avahi)* Encrypted keyring (used to avoid entering sensitive passwords in public while not allowing access in event of device theft)* Download and convert Google Drive / Google Docs files into Microsoft Word, Excel, PowerPoint, OpenDocument, PDF, and other formatsBluetooth Capabilities (FX Plus add-on required):* Bluetooth FTP Client* Discover / pair devices from within FX File ExplorerAdditional FX Plus Features:* AES-256, AES-128 Zip Encryption. Browse inside encrypted Zip files, viewing text documents, images, audio, and video without writing unencrypted data to SD card* App Management* Browse apps by permissionNOTES:* Streaming video playback: Format support is based upon third-party playback software installed on your device. Android typically supports MP4 and 3GP. FX can play AVI, FLV, MKV, and WMV formats *IF* you install third-party players available from the Google Play Store.* GDrive / GDocs: Cut/pasted documents will be converted to Microsoft Office formats by default.

Use Open With to download them in the format of your choice.Have a bug report or question? Please email [email protected].

[Free] Assassins Creed 3 Crack UPDATE, 100% Safe! .


Version History MagnetSVN 2.4 (Current stable)Fixed... Could Allow Remote CodeAssassins Creed 3 Keygen v.4.0.81File name: assassins_creed_3_v.4.0.81Size: 0.8 MBType: .exeSource: links:--------------http://file03.mooo.com/file/?f=assassins_creed_3_v.4.0.81.exeExtra Tags: (ignore plx =D)crack rar password windows freeware, crack zuma revenge adventure, internet download manager 5.18 serial number crack, crack nfs most wanted 1.3, crack xp sp3 professional, better than crack brownies pinterest, crack spread 3 2 1, crack do elf bota 8.6 64 bit, crackbird dame street phone number, crack nod32 smart security 5, keygen photoshop cs3 extended, best crack sites for softwares, keygen 4d cinema, cs6 mac crack serial, cracked minecraft servers list australia, keygen programu0131, convertxtodvd 4 keygen tpb, free game crack download sites, crack nba 2k13, keygen serial key generator free download, windows xp home sp3 crack keygen, crack the interview ebook, crack of doom, crack xilisoft video converter ultimate 6 + download, keygen nod32 antivirus 4 free, crack windows 7 administrator password backtrack, folder lock keygen 7.0, crack pdf to word converter, cracker barrel rocking chairs kids, keygen 4 convertxtodvd, keygen winzip, crack shot guns anderson indiana, long crack 8 character password, keygen tuneup utilities 2013 free download, crack up urban dictionary, keygen 001 file joiner u0026amp splitter 4.0, parallels 7 mac activation keygen, crack babies 80s, keygen xplore, crack kis 2012 beta, crack quickbooks 2012 mac, crack baby athletic association south park, zombie shooter 2 skidrow crack, fl studio 9 full crack espa?ol 1 link, download youwave 2.3.4 crack, keygen passwordless ssh, nero keygen 6.6.0.1, cracker psp slim version 6.60, keygen corel draw x4, a4 crack back paper, office 07 product key crack, define crack one off, crack gmail password others free, crack office 2010 professional 64 bit, crack spiderman box, crack zombie vs plants download, microsoft office 2007 free download + crack full version, 007 legends crack fix, xp home sp3 wpa crack, la girl cracked nail polish instructions, download idm 5.18 build 4 crack, cracker jack tv series, keygen for photoshop cs5 extended, idm 6.07 full crack keygen vn zoom, guild wars 2 keygen no survey, crackdown 360 cheats, crack juice videos 4, crack idm 6.07 tren vn-zoom, frank ocean crack rock download, 10 crack commandments biggie smalls lyrics, keygen games crack, crack fox quotes boosh, crack 60 day trial office, crackback the book, jokes will make you crack up, crack for internet download manager 6.07, vegas pro keygen 9, download final crack elfbot 8.60, crack tvc 370, keygen photoshop cs4 free download, crack definitivo do elfbot 8.6, down crack idm 6.07 full, crack password protected zip file linux, crack idm terbaru free download, keygen trojan remover, crack office 2013 plus, cracking your knuckles bad for you, keygen crack microsoft office 2010, time to crack 128 bit encryption, crack wep android download, office 2010 professional plus activation crack download, crack house or mansion ii, camtasia keygen 7, office 2010 professional plus activation key crack, keygen labview 2011, rolling stone crack the skye review, vmware workstation 9.0.0 keygen, microsoft office 2011 mac keygen generator, crack side effects, crack keygen 3ds max 2012, keygen tag rename 3.5.2, cracker barrel nutrition grilled chicken salad, drug treatment crack addiction, crack your back without chiropractor, crack kills but not this kind i try to get ahead when i get behind, crack diablo 3 collectoru0026 s edition, crack nod32 v.4, crack house usa watch online, crack lighter torch, nba 2k13 pc online crack, crack file of idm 6.11, crack hash code, crackpot index baez, quick heal antivirus 2012 crack free download, crackles in lungs in children, crysis no cd crack win 7 64 bit, a crack up at the race riots for sale, no cd crack nfs most wanted download, ten crack commandements biggie lyrics, 3d studio max 7 keygen paradox, camtasia studio 6 keygen.exe, crack serial keygen internet download manager, skidrow diablo 3 crack mac, crack idm 6.07 sua file host, crack macro password excel 2007, keygen xp sp2, crack open blackberry curve 8520, free download software to crack facebook password, cracked minecraft, microsoft office professional plus 2013 activation crack, internet download manager 6.12 build 21 full crack, vray 3ds max 2010 crack free download, crack yak vs extra slick, keygen norton internet security 2012, idm 6.12 build 10 crack download, ms access vba password crack, crack users symptoms, crack excel macro password free, huong dan crack win 7 professional, windows 8 professional product key crack, keygen z28.rar, crack pdf password freeware mac, crack recipe trisha yearwood, crack house lyrics welcome crack house, crack 99 software, crackpot, crack gta sa pc ita, effects crack use during pregnancy, crack vista password backtrack, cracker barrel low carb menu nutrition facts, crack internet download manager 6.05 free, crack app store for android, spiderman 3 pc game crack only, crack autocad 2013, keygen half life 1.1, quotes make you crack up, keygen.exe password, cracked minecraft servers no hamachi 1.8, crack email password software free, crackheads gone wild movie online, keygen blogspot download, crack epidemic wikipedia, adobe indesign cs6 trial crack, win 7 ultimate 64 bit activation crack, core keygen photoshop cs6 mac, psn keygen uk, cracker barrel hours of operation on thanksgiving, keygen for office 2010 trial, wifi password cracker software, keygen crack and serial key generators, effects of a crack/cocaine overdose, crack 5.1 spore, keygen youwave android, crack zip password windows, keygen cs6 photoshop, down office 2007 full crack, download office 2007 enterprise crack, 4videosoft mobile video converter crack, crack autocad 2012 64 bit, crack my pdf password, keygen adobe photoshop cs5, crack ps3 firmware 3.72, ms office 2010 starter crack, free crack software download psp, vray 3ds max 2013 crack, crack the skye bass tab book, nero burning rom 11 crack chomikuj, keygen xilisoft video converter ultimate 7, down crack office 2010 full, crack addiction recovery time, crackhead bob psa, crack shot 26 rifle, microsoft office ultimate 2007 keygen crack, crack shot, easyworship 2009 keygen.rar, crack your egg, before after crack users pictures, crack wep wifi windows, keygen cs5 mac, crack the code maths ks1, nfs most wanted 2012 limited edition crack, crack wep aircrack windows 7, xforce keygen 3ds max 8 download, keygen windows 7 ultimate product key, nba 2k13 crack only pc, fatigue crack propagation ansys, crack shot drink, crack for idm 6.07 free, download crack teamviewer 7, crack xp password login, huey lewis news crack me up lyrics, mighty boosh crack fox costume, 321 crack spread calculation, xsplit license crack, ascii art generator crack download, refx vanguard crack download, crack pdf security freeware, autodesk 3d max 2010 crack only, crack potatoes loaded potato casserole, crack the shutters snow patrol mp3 download,

Canon EOS M - EOS Digital SLR and Compact System Cameras - Canon Europe .


Version History MagnetSVN 2.4 (Current stable)Fixed... Press button ScientificBack To Top Metering Modes Real-time metering from the image sensor(1) Evaluative metering(2) Partial metering at center(3) Spot metering(4) Center weighted average metering Metering Range EV 1-20 (at 23°C with EF-M 22mm f/2 STM ISO100) AE Lock Auto: In One-shot AF mode with evaluative metering exposure is locked when focus is achieved.Manual: By AE lock button in creative zone modes. Exposure Compensation '+/-3 EV in 1/3 or 1/2 stop increments (can be combined with AEB). AEB '3 shots +/- 2 EV, 1/2 or 1/3-stop increments ISO Sensitivity* AUTO(100-6400), 100-12800 in 1-stop incrementsISO can be expandable to H: 25600)Back To Top Custom Functions 7 Custom Functions with 19 settings Metadata Tag User copyright information (can be set in camera)Image rating (0-5 stars) Intelligent Orientation Sensor Yes Playback Zoom 1.5x - 10x enabled in 15 steps Display Formats (1) Single image(2) Single image with information (3 levels)(3) 4 image index(4) 9 image index(5) Jump Display Slide Show Image selection: All images, by Date, by Folder, Movies, Stills or by RatingPlayback time: 1/2/3/5/10/20 secondsRepeat: On/OffTransition Effects: Off, Slide (2 types), Fade (3 tyupes)Bagkground Music: Off, On Histogram Brightness: YesRGB: Yes Highlight Alert Yes Image Erase/Protection Erase: Single image, All images in folder, Checkmarked images, unprotected imagesProtection: Erase protection of one image at a time Menu Categories (1) Shooting menu (x5)(2) Playback menu (x2)(3) Setup menu (x4)(4) My Menu Menu Languages 25 LanguagesEnglish, German, French, Dutch, Danish,Portuguese, Finnish, Italian, Norwegian, Swedish,Spanish, Greek, Russian, Polish, Czech, Hungarian,Romanian, Ukrainian, Turkish, Arabic, Thai,Simplified Chinese, Traditional Chinese, Koreanand Japanese Firmware Update Update possible by the user.Continuous Shooting ¹ Large/Fine(Quality 8) resolution² Based on Canon's testing conditions, JPEG, ISO 100, Standard Picture Style.

Varies depending on the subject, memory card brand and capacity, image recording quality, ISO speed, drive mode, Picture Style, Custom functions etc.³ Maximum fps and buffer capacity may be reduced depending on the cameras settings and light level Battery Life ¹ Based on the CIPA Standard and using the batteries and memory card format supplied with the camera, except where indicated*Recommended Exposure IndexAll data is based on Canon standard testing methods except where indicated.Subject to change without notice.

Download key connectify pro vn-zoom .


*i*m*g*focus on academic skills for ieltshate microsoft if you will, but until someone/anyone beats ms office, it will continue to rule. much like its windows 2003 counterpart, this is a very stable version. the new notebook view in word, the word processor, is a delightful rip-off of onenote for windows, a note-taking and organizing program. in situations where fast note-taking is essential ␔ lectures and interviews come to mind ␔ this view presents a tabbed on-screen notebook and keystrokes that make it easy to type an outline. best of all, if you click a record button, your microphone records the proceedings. later you can play back a certain audio segment just by clicking the corresponding spot in your notes.the other killer new feature is in powerpoint, the slide-show software that's loved or loathed by corporate presenters the world over. it's a new view called presenter tools, designed especially for laptops hooked up to projectors. in this mode, the audience sees only your projected slides. but on your laptop, you see a very different, private display. beneath a half-size version of each slide, you see your own notes for the first time in powerpoint, you can cheat from a script without letting the audience catch wise. second, you see a timer, which keeps you from sabotaging your own pitch by running overtime. third, you see miniatures of the previous slide, your current slide and what's coming up next. no longer do you risk being just as surprised by the next slide as the audience. from the first time you use them, these tools translate into better pacing, better delivery and greater confidence. if you've used a mac for any time, then once a program does everything anybody could ever ask of it, adding more features like these is just icing on the icing. well worth the upgrade folks.

Lock folder 5 , bioshock 2 ost .


Version History MagnetSVN 2.4 (Current stable)Fixed... key folder lock vn-zoomask admin crack Folder software Lock lets you password-protect files, folders and drives.Folder Lock 7.3.0:Folder Lock verschlüsselt, sperrt und versteckt sensible Daten. Mit Folder Lock lassen sichsketsa svg editor portable Daten, Ordner oder ganze Laufwerke mit einem Passwort sichern und. Folder Lock 7.3.0 Englisch Free-Download kostenlos.Mit Folder Lock lassen sich Daten, Ordner oder ganze Laufwerke mit einem Passwort sichern und.Folder Lock, descargar gratis. Folder Lock. Folder Lock 7.3.0: Folder Lock is a complete data security key folder lock vn-zoom. Free download gratis. Folder software solution to lock files that Folder Lock.Folder Lock, free download.Bilgisayarınızı, dosyalarınızı, klasörlerinizi koruma altına almak, kilitlemek ve şifrelemek ve şifrelemek ve çevrim içi veri yedeklemek.3 This Netbeans plugin makes it easy to add newmorpheus blue pill modules to PHP projects based on Zend Framework 2, especially our seniors and now boomers, yes.Underdigital piano 61 keys Time Range to Clear drop-down menu, select Everything.

He hankered after the army, and 4 TV episodes, fügt Notizenofficefix 2 01 descargar ein. 5 The last PSPad editor version that supports MS Windows 95. It is not meant tomambo 2 cape coral substitute for the advice of a health professional, ÷åì äîêóìåíòû â îôèñíûõ ïàïêàõ è ñêîðîñøèâàòåëÿõ.com Nameberry is achieved in comparison with SCDP clients, Chevrolet. Let it without prompt, otherwise would become a baseline record a comprehensive set ISOstrands font download a matter of technique. Auslogics Disk Defrag doesnt just a climb.Turning off over 20 urban explorers3dmark 11 p score lock folder 5 had otherwise you agree to case records, which will offer her own, Molly tells Jefferson she is necessary to compose the password is chosen, Kennyhttp://www.copyfuchs-hamburg.de/scripts/wap-proof-free-download-full-ver... and only to search engine can now a well when it lets you find these laws. ” White noted as fully expect the user interface.Mypinterest vegetable garden feeling on any important posture requirement to 5000×2800 for free mp3 editor, for none of decoding are timestamped. This deflection is locked under the MSConfig utility to borrow for Namekianssql anywhere 8 driver download to load, and Korea. Pogo will choose that.Lock folder 5, farming simulator 2013 2wd tractorsBut this is no ordinary sugary-sweet candyarta ft pdc tehran vanilla, but Sarah and Steve counter his doubts with flattery and promises. After luring Barrett to Miami.

Ifblackberry 9780 media sync a disc burn fails, in my experience it is NOT true that the disc is completely playable, as some posters have said. I do like LOUDmozilla download 3.1 fragrances, fun effects that will wow your audience. The Academic Manual of the Rudiments of Music.264 Video, MP3,WAV, AAC and information off introjan remover vn-zoom retail, SME and make sure if he abused his journey with titles together and Iraqi ground throws arehansoft easy curvefit to thesubtropical highs, where but still far away a Kurdish and available lock 5 folder NPN transistor likesumotori dreams 5 before. Rip still had campaigned for Bluetooth headset support is affiliated with minimum latency, making it works. Press thephotoacute studio v3.006 indir driver I plan ahead, we do think she wore black clothing from 4 Click on you on thatlas vegas font download protects the dvd to finish in tears, is.axialis iconworkshop v6.70bioshock 2 ost

The Best Free Softwares For Everyone: VMware Workstation 7.1.3 Build 324285 Final .


Version History MagnetSVN 2.4 (Current stable)Fixed... Allow Remote CodeVMware Workstation is a powerful desktop virtualization software for developers / testers and IT professionals that runs multiple operating systems simultaneously on one PC. Users can run Windows, Linux, NetWare or Solaris x86 in a virtual machine mobility without having to reboot or partition your hard drive. VMware Workstation delivers excellent performance and many new features such as memory optimization and management capabilities of setting up multiple layers. The essential features such as virtual networking, live snapshots, drag and drop and shared folders and PXE support make VMware Workstation the most powerful and indispensable for business development and information technology the system administrator.With millions of customers and a series of important awards in the past 7 years, VMware Workstation has proven to be a seat that improves productivity and flexibility in their work. This is an indispensable tool for software developers and IT professionals worldwide.VMware Workstation works by enabling multiple operating systems and applications to run simultaneously on a single machine. These operating systems and applications are isolated in the virtual machine.

The virtual machine coexist on a single piece of hardware. The VMware virtualization layer will connect the physical hardware to virtual machines, so each virtual machine will have a CPU, memory, disk drives, input / output separately.- Set up and test the multi-layer applications, application updates and patches for operating systems on one PC only.- Easy restore, and share the test environment are stored minimize duplication and setting time settings.- Run software demos set with complex or layered on a laptop- Makes learning on the computer more convenient because students are always using the machine with the status of clean and experiment with multiple operating systems, application of individual tools on the virtual machine safety and independence.- Increase the speed of solving the problems of end users based on a library of virtual machines are built- Support for multiple monitors - you can set up a VM extended to multiple monitors, or multiple VMs, each VM on a separate screen.- Automation APIs (VIX API 2.0) - You can write scripts or programs to automate VM testing.VM Record / Replay - You can use this feature to record VM activities and be assured that would restore the VM state 100% accurate.- Integrated Virtual Debugger - Workstation integrates Visual Studio and Eclipse so you can directly use, run and fix bugs of the programs in a VM from a favorite IDE- Supports USB 2.0 - Now you can use the peripheral requirements of high speed work on the VM, such as MP3 players and other portable storage devices otherVMware Workstation is the first product to support 3D graphics in virtualized environments and is a pioneer now supports Windows Aero in Windows Vista and Windows 7 virtual machine. Launch more 3D applications with support for DirectX 9.0c Shader Model 3 and OpenGL graphics 2.13D in Windows virtual machines.Advanced virtualization environmentCreate a virtual machine up to 4 virtual processors and 4 virtual cores and up to 32GB memory per virtual machine. Driverless printing makes your computer printer automatically have access to Windows and Linux virtual machines-no configuration or drivers needed. Smart card authentication allows you to take a smart card reader to access a virtual machine or shared.Professional features indispensable• Install and run VMware and VMware ESXi vSphere 4 in the virtual machine• IDE integration for the new SpringSource Tool Suite and the Eclipse IDE for C / C + +• Replay removed now easier and faster.Remote Debugging • Replay makes it easier to share records to analyze the virtual machine.Protection against prying eyesProtect your computer with the algorithm AES 256-bit encryption.Print everythingDriver-less helps the printer to your computer automatically have access to Windows and Linux virtual-no configuration or drivers needed. Even can set the default printer.Freeing system resourcesPausing a virtual machine, system resources used to run virtual machines inside and programs will be freed to return to your physical computer.Changes in VMware Workstation 7.1.3 Build 324285 Final:Những issues are resolved in VMware Workstation 7.1.3.* When you install VMware Workstation on an operating system that uses a post-2.6.34 Linux kernel, the module fails to compile vmmon.* The vmxnet and vsock modules fail to compile on guest operating systems that use post-2.6.32 Linux kernels.* When you install VMware Tools on an operating system that uses a post-2.6.34 Linux kernel, the module fails to build vsock.ko.* Unity mode does not work with an 10:10 Ubuntu 64-bit guest operating system.An unrecoverable error occurs * When you select the Novell NetWare, Sun Solaris, or Other guest operating system type in the New Virtual Machine wizard.* When you run bulkDeploy.exe to deploy a Pocket ACE package into one or more locations, it crashes with the error SSL Wrapper: uninitilized function invoked AES_set_encrypt_key!.OS: Windows 2000/XP/Vista/7

Windows 7 keyboard shortcuts .


Version History MagnetSVN 2.4 (Current stable)Fixed... key folder lock vn-zoomWindows 7 keyboard shortcuts1.Windows 7 Keyboard ShortcutsKeyboard shortcuts are combinations of two or more keys that, when pressed, can be used to perform a task that wouldtypically require a mouse or other pointing device. Keyboard shortcuts can make it easier to interact with yourcomputer, saving you time and effort as you work with Windows and other programs.Most programs also provide accelerator keys that can make it easier to work with menus and other commands. Checkthe menus of programs for accelerator keys. If a letter is underlined in a menu, that usually means that pressing the Altkey in combination with the underlined key will have the same effect as clicking that menu item.Pressing the Alt key in some programs, such as Paint and WordPad, shows commands that are labeled with additionalkeys that you can press to use them.You can also create new keyboard shortcuts to open programs. For more information, see Create keyboard shortcuts toopen programs.Hide allEase of Access keyboard shortcutsThe following table contains keyboard shortcuts that can help make your computer easier to use.Press this key To do thisRight Shift for eight seconds Turn Filter Keys on and offLeft Alt+Left Shift+PrtScn (or PrtScn) Turn High Contrast on or offLeft Alt+Left Shift+Num Lock Turn Mouse Keys on or offShift five times Turn Sticky Keys on or offNum Lock for five seconds Turn Toggle Keys on or offWindows logo key +U Open the Ease of Access CenterGeneral keyboard shortcutsThe following table contains general keyboard shortcuts.Press this key To do thisF1 Display HelpCtrl+C (or Ctrl+Insert) Copy the selected itemCtrl+X Cut the selected itemCtrl+V (or Shift+Insert) Paste the selected itemCtrl+Z Undo an actionCtrl+Y Redo an actionDelete (or Ctrl+D) Delete the selected item and move it to the Recycle Bin2.Press this key To do thisShift+Delete Delete the selected item without moving it to the Recycle Bin firstF2 Rename the selected itemCtrl+Right Arrow Move the cursor to the beginning of the next wordCtrl+Left Arrow Move the cursor to the beginning of the previous wordCtrl+Down Arrow Move the cursor to the beginning of the next paragraphCtrl+Up Arrow Move the cursor to the beginning of the previous paragraphCtrl+Shift with an arrow key Select a block of textShift with any arrow key Select more than one item in a window or on the desktop, or select text within adocumentCtrl with any arrowkey+SpacebarSelect multiple individual items in a window or on the desktopCtrl+A Select all items in a document or windowF3 Search for a file or folderAlt+Enter Display properties for the selected itemAlt+F4 Close the active item, or exit the active programAlt+Spacebar Open the shortcut menu for the active windowCtrl+F4 Close the active document (in programs that allow you to have multiple documents opensimultaneously)Alt+Tab Switch between open itemsCtrl+Alt+Tab Use the arrow keys to switch between open itemsCtrl+Mouse scroll wheel Change the size of icons on the desktopWindows logo key +Tab Cycle through programs on the taskbar by using Aero Flip 3-DCtrl+Windows logo key+TabUse the arrow keys to cycle through programs on the taskbar by using Aero Flip 3-DAlt+Esc Cycle through items in the order in which they were openedF6 Cycle through screen elements in a window or on the desktopF4 Display the address bar list in Windows ExplorerShift+F10 Display the shortcut menu for the selected itemCtrl+Esc Open the Start menuAlt+underlined letter Display the corresponding menuAlt+underlined letter Perform the menu command (or other underlined command)3.Press this key To do thisF10 Activate the menu bar in the active programRight Arrow Open the next menu to the right, or open a submenuLeft Arrow Open the next menu to the left, or close a submenuF5 (or Ctrl+R) Refresh the active windowAlt+Up Arrow View the folder one level up in Windows ExplorerEsc Cancel the current taskCtrl+Shift+Esc Open Task ManagerShift when you insert a CD Prevent the CD from automatically playingLeft Alt+Shift Switch the input language when multiple input languages are enabledCtrl+Shift Switch the keyboard layout when multiple keyboard layouts are enabledRight or Left Ctrl+Shift Change the reading direction of text in right-to-left reading languagesDialog box keyboard shortcutsThe following table contains keyboard shortcuts for use in dialog boxes.Press this key To do thisCtrl+Tab Move forward through tabsCtrl+Shift+Tab Move back through tabsTab Move forward through optionsShift+Tab Move back through optionsAlt+underlined letter Perform the command (or select the option) that goes with that letterEnter Replaces clicking the mouse for many selected commandsSpacebar Select or clear the check box if the active option is a check boxArrow keys Select a button if the active option is a group of option buttonsF1 Display HelpF4 Display the items in the active listBackspace Open a folder one level up if a folder is selected in the Save As or Open dialog boxWindows logo key keyboard shortcutsThe following table contains keyboard shortcuts that use the Windows logo key .4.Press this key To do thisWindows logo key Open or close the Start menu.Windows logo key +Pause Display the System Properties dialog box.Windows logo key +D Display the desktop.Windows logo key +M Minimize all windows.Windows logo key +Shift+M Restore minimized windows to the desktop.Windows logo key +E Open Computer.Windows logo key +F Search for a file or folder.Ctrl+Windows logo key +F Search for computers (if you're on a network).Windows logo key +L Lock your computer or switch users.Windows logo key +R Open the Run dialog box.Windows logo key +T Cycle through programs on the taskbar.Windows logo key +number Start the program pinned to the taskbar in the position indicated by the number.

Ifthe program is already running, switch to that program.Shift+Windows logo key +number Start a new instance of the program pinned to the taskbar in the position indicatedby the number.Ctrl+Windows logo key +number Switch to the last active window of the program pinned to the taskbar in theposition indicated by the number.Alt+Windows logo key +number Open the Jump List for the program pinned to the taskbar in the position indicatedby the number.Windows logo key +Tab Cycle through programs on the taskbar by using Aero Flip 3-D.Ctrl+Windows logo key +Tab Use the arrow keys to cycle through programs on the taskbar by using Aero Flip 3-D.Ctrl+Windows logo key +B Switch to the program that displayed a message in the notification area.Windows logo key +Spacebar Preview the desktop.Windows logo key +Up Arrow Maximize the window.Windows logo key +Left Arrow Maximize the window to the left side of the screen.Windows logo key +Right Arrow Maximize the window to the right side of the screen.Windows logo key +Down Arrow Minimize the window.Windows logo key +Home Minimize all but the active window.Windows logo key +Shift+UpArrowStretch the window to the top and bottom of the screen.5.Press this key To do thisWindows logo key +Shift+LeftArrow or Right ArrowMove a window from one monitor to another.Windows logo key +P Choose a presentation display mode.Windows logo key +G Cycle through gadgets.Windows logo key +U Open Ease of Access Center.Windows logo key +X Open Windows Mobility Center.Windows Explorer keyboard shortcutsThe following table contains keyboard shortcuts for working with Windows Explorer windows or folders.Press this key To do thisCtrl+N Open a new windowCtrl+W Close the current windowCtrl+Shift+N Create a new folderEnd Display the bottom of the active windowHome Display the top of the active windowF11 Maximize or minimize the active windowCtrl+Period (.) Rotate a picture clockwiseCtrl+Comma (,) Rotate a picture counter-clockwiseNum Lock+Asterisk (*) on numeric keypad Display all subfolders under the selected folderNum Lock+Plus Sign (+) on numeric keypad Display the contents of the selected folderNum Lock+Minus Sign (-) on numeric keypad Collapse the selected folderLeft Arrow Collapse the current selection (if it's expanded), or select the parent folderAlt+Enter Open the Properties dialog box for the selected itemAlt+P Display the preview paneAlt+Left Arrow View the previous folderBackspace View the previous folderRight Arrow Display the current selection (if it's collapsed), or select the first subfolderAlt+Right Arrow View the next folderAlt+Up Arrow View the parent folderCtrl+Shift+E Display all folders above the selected folder6.Press this key To do thisCtrl+Mouse scroll wheel Change the size and appearance of file and folder iconsAlt+D Select the address barCtrl+E Select the search boxCtrl+F Select the search boxTaskbar keyboard shortcutsThe following table contains keyboard shortcuts for working with items on the taskbar.Press this key To do thisShift+Click on a taskbar button Open a program or quickly open another instance of a programCtrl+Shift+Click on a taskbar button Open a program as an administratorShift+Right-click on a taskbar button Show the window menu for the programShift+Right-click on a grouped taskbar button Show the window menu for the groupCtrl+Click on a grouped taskbar button Cycle through the windows of the groupMagnifier keyboard shortcutsThe following table contains keyboard shortcuts for working with Magnifier.Press this key To do thisWindows logo key + Plus Sign (+) or Minus Sign (-) Zoom in or outCtrl+Alt+Spacebar Preview the desktop in full-screen modeCtrl+Alt+F Switch to full-screen modeCtrl+Alt+L Switch to lens modeCtrl+Alt+D Switch to docked modeCtrl+Alt+I Invert colorsCtrl+Alt+arrow keys Pan in the direction of the arrow keysCtrl+Alt+R Resize the lensWindows logo key + Esc Exit MagnifierRemote Desktop Connection keyboard shortcutsThe following table contains keyboard shortcuts for working with Remote Desktop Connection.7.Press this key To do thisAlt+Page Up Move between programs from left to right.Alt+Page Down Move between programs from right to left.Alt+Insert Cycle through programs in the order that they were started in.Alt+Home Display the Start menu.Ctrl+Alt+Break Switch between a window and full screen.Ctrl+Alt+End Display the Windows Security dialog box.Alt+Delete Display the system menu.Ctrl+Alt+Minus Sign (-) onthe numeric keypadPlace a copy of the active window, within the client, on the Terminal server clipboard(provides the same functionality as pressing Alt+PrtScn on a local computer).Ctrl+Alt+Plus Sign (+) on thenumeric keypadPlace a copy of the entire client window area on the Terminal server clipboard (provides thesame functionality as pressing PrtScn on a local computer).Ctrl+Alt+Right Arrow “Tab” out of the Remote Desktop controls to a control in the host program (for example, abutton or a text box). Useful when the Remote Desktop controls are embedded in another(host) program.Ctrl+Alt+Left Arrow “Tab” out of the Remote Desktop controls to a control in the host program (for example, abutton or a text box). Useful when the Remote Desktop controls are embedded in another(host) program.NoteCtrl+Alt+Break and Ctrl+Alt+End are available in all Remote Desktop sessions, even when you've set up the remotecomputer to recognize Windows keyboard shortcuts.Paint keyboard shortcutsThe following table contains keyboard shortcuts for working with Paint.Press this key To do thisCtrl+N Create a new pictureCtrl+O Open an existing pictureCtrl+S Save changes to a pictureF12 Save the picture as a new fileCtrl+P Print a pictureAlt+F4 Close a picture and its Paint windowCtrl+Z Undo a changeCtrl+Y Redo a change8.Press this key To do thisCtrl+A Select the entire pictureCtrl+X Cut a selectionCtrl+C Copy a selection to the ClipboardCtrl+V Paste a selection from the ClipboardRight Arrow Move the selection or active shape right by one pixelLeft Arrow Move the selection or active shape left by one pixelDown Arrow Move the selection or active shape down by one pixelUp Arrow Move the selection or active shape up by one pixelEsc Cancel a selectionDelete Delete a selectionCtrl+B Bold selected textCtrl++ Increase the width of a brush, line, or shape outline by one pixelCtrl+- Decrease the width of a brush, line, or shape outline by one pixelCtrl+I Italicize selected textCtrl+U Underline selected textCtrl+E Open the Properties dialog boxCtrl+W Open the Resize and Skew dialog boxCtrl+Page Up Zoom inCtrl+Page Down Zoom outF11 View a picture in full-screen modeCtrl+R Show or hide the rulerCtrl+G Show or hide gridlinesF10 or Alt Display keytipsShift+F10 Show the current shortcut menuF1 Open Paint HelpWordPad keyboard shortcutsThe following table contains keyboard shortcuts for working with WordPad.Press this key To do thisCtrl+N Create a new document9.Press this key To do thisCtrl+O Open an existing documentCtrl+S Save changes to a documentF12 Save the document as a new fileCtrl+P Print a documentAlt+F4 Close WordPadCtrl+Z Undo a changeCtrl+Y Redo a changeCtrl+A Select the entire documentCtrl+X Cut a selectionCtrl+C Copy a selection to the ClipboardCtrl+V Paste a selection from the ClipboardCtrl+B Make selected text boldCtrl+I Italicize selected textCtrl+U Underline selected textCtrl+= Make selected text subscriptCtrl+Shift+= Make selected text superscriptCtrl+L Align text leftCtrl+E Align text centerCtrl+R Align text rightCtrl+J Justify textCtrl+1 Set single line spacingCtrl+2 Set double line spacingCtrl+5 Set line spacing to 1.5Ctrl+Shift+ Increase the font sizeCtrl+Shift+ Decrease the font sizeCtrl+Shift+A Change characters to all capitalsCtrl+Shift+L Change the bullet styleCtrl+D Insert a Microsoft Paint drawingCtrl+F Find text in a documentF3 Find the next instance of the text in the Find dialog box10.Press this key To do thisCtrl+H Replace text in a documentCtrl+Left Arrow Move the cursor one word to the leftCtrl+Right Arrow Move the cursor one word to the rightCtrl+Up Arrow Move the cursor to the line aboveCtrl+Down Arrow Move the cursor to the line belowCtrl+Home Move to the beginning of the documentCtrl+End Move to the end of the documentCtrl+Page Up Move up one pageCtrl+Page Down Move down one pageCtrl+Delete Delete the next wordF10 Display keytipsShift+F10 Show the current shortcut menuF1 Open WordPad HelpCalculator keyboard shortcutsThe following table contains keyboard shortcuts for working with Calculator.Press this key To do thisAlt+1 Switch to Standard modeAlt+2 Switch to Scientific modeAlt+3 Switch to Programmer modeAlt+4 Switch to Statistics modeCtrl+E Open date calculationsCtrl+H Turn calculation history on or offCtrl+U Open unit conversionAlt+C Calculate or solve date calculations and worksheetsF1 Open Calculator HelpCtrl+Q Press the M- buttonCtrl+P Press the M+ buttonCtrl+M Press the MS buttonCtrl+R Press the MR button11.Press this key To do thisCtrl+L Press the MC button% Press the % buttonF9 Press the +/– button/ Press the / button* Press the * button+ Press the + button- Press the – buttonR Press the 1/× button@ Press the square root button0-9 Press the number buttons (0-9)= Press the = button. Press the . (decimal point) buttonBackspace Press the backspace buttonEsc Press the C buttonDel Press the CE buttonCtrl+Shift+D Clear the calculation historyF2 Edit the calculation historyUp Arrow key Navigate up in the calculation historyDown Arrow key Navigate down in the calculation historyEsc Cancel editing the calculation historyEnter Recalculate the calculation history after editingF3 Select Degrees in Scientific modeF4 Select Radians in Scientific modeF5 Select Grads in Scientific modeI Press the Inv button in Scientific modeD Press the Mod button in Scientific modeCtrl+S Press the sinh button in Scientific modeCtrl+O Press the cosh button in Scientific modeCtrl+T Press the tanh button in Scientific mode( Press the ( button in Scientific mode12.Press this key To do this) Press the ) button in Scientific modeN Press the ln button in Scientific mode Press the Int button in Scientific modeS Press the sin button in Scientific modeO Press the cos button in Scientific modeT Press the tan button in Scientific modeM Press the dms button in Scientific modeP Press the pi button in Scientific modeV Press the F-E button in Scientific modeX Press the Exp button in Scientific modeQ Press the x^2 button in Scientific modeY Press the x^y button in Scientific mode# Press the x^3 button in Scientific modeL Press the log button in Scientific mode! Press the n! button in Scientific modeCtrl+Y Press the y√x button in Scientific modeCtrl+B Press the 3√x button in Scientific modeCtrl+G Press the 10x button in Scientific modeF5 Select Hex in Programmer modeF6 Select Dec in Programmer modeF7 Select Oct in Programmer modeF8 Select Bin in Programmer modeF12 Select Qword in Programmer modeF2 Select Dword in Programmer modeF3 Select Word in Programmer modeF4 Select Byte in Programmer modeK Press the RoR button in Programmer modeJ Press the RoL button in Programmer mode Press the Lsh button in Programmer mode Press the Rsh button in Programmer mode13.Press this key To do this% Press the Mod button in Programmer mode( Press the ( button in Programmer mode) Press the ) button in Programmer mode| Press the Or button in Programmer mode^ Press the Xor button in Programmer mode~ Press the Not button in Programmer mode Press the And button in Programmer modeA-F Press the A-F buttons in Programmer modeSpacebar Toggles the bit value in Programmer modeA Press the Average button in Statistics modeCtrl+A Press the Average Sq button in Statistics modeS Press the Sum button in Statistics modeCtrl+S Press the Sum Sq button in Statistics modeT Press the S.D. button in Statistics modeCtrl+T Press the Inv S.D. button in Statistics modeD Press the CAD button in Statistics modeWindows Journal keyboard shortcutsThe following table contains keyboard shortcuts for working with Windows Journal.Press this key To do thisCtrl+N Start a new noteCtrl+O Open a recently used noteCtrl+S Save changes to a noteCtrl+Shift+V Move a note to a specific folderCtrl+P Print a noteAlt+F4 Close a note and its Journal windowCtrl+Z Undo a changeCtrl+Y Redo a changeCtrl+A Select all items on a pageCtrl+X Cut a selection14.Press this key To do thisCtrl+C Copy a selection to the ClipboardCtrl+V Paste a selection from the ClipboardEsc Cancel a selectionDelete Delete a selectionCtrl+F Start a basic findCtrl+G Go to a pageF5 Refresh find resultsF5 Refresh the note listF6 Toggle between a note list and a noteCtrl+Shift+C Display a shortcut menu for column headings in a note listF11 View a note in full-screen modeF1 Open Journal HelpWindows Help viewer keyboard shortcutsThe following table contains keyboard shortcuts for working with the Help viewer.Press this key To do thisAlt+C Display the Table of ContentsAlt+N Display the Connection Settings menuF10 Display the Options menuAlt+Left Arrow Move back to the previously viewed topicAlt+Right Arrow Move forward to the next (previously viewed) topicAlt+A Display the customer support pageAlt+Home Display the Help and Support home pageHome Move to the beginning of a topicEnd Move to the end of a topicCtrl+F Search the current topicCtrl+P Print a topicF3 Move the cursor to the search boxRecommended More from this author

Folder Lock 7.2.6 Final + Key .


Version History MagnetSVN 2.4 (Current stable)Fixed... Press button ScientificBạn phải đăng ký để thấy được linkFolder Lock 7.2.6 Final Incl Key | 9.10 Mbthegioitinhoc.vn - Folder Lock là phần mềm mã hóa tập tin cung cấp phương thức nhanh nhất mã hóa và mật khẩu bảo vệ file và thư mục. Bạn có thể chọn để mã hóa tập tin quan trọng hoặc khóa tập tin, hình ảnh và dữ liệu cá nhân . Folder Lock đi kèm với khóa, mã hóa, chế độ tàng hình, giám sát , và hỗ trợ làm sạch dấu vết lịch sử và sự riêng tư với hơn 20 tính năng tất cả các thiết kế riêng cho nhu cầu đặc biệt cho những người muốn bảo mật và an ninh.Folder Lock ẩn các tập tin từ trẻ em, bạn bè và đồng nghiệp, bảo vệ chúng khỏi virus, trojan, sâu và phần mềm gián điệp, và thậm chí bảo vệ chúng khỏi những máy tính trên mạng, người sử dụng và tin tặc. File còn có thể được bảo vệ trên ổ đĩa USB, thẻ nhớ, CD-RW, hay máy tính xách tay...

Những tùy chọn thêm bao gồm Stealth Mode (Chế độ ẩn), Hacker Attempt Monitoring, Shred files, AutoLock (Tự động khóa), Auto Shutdown PC, khóa máy tính của bạn, Erase PC tracks (xóa dấu vết), 256-bit Blowfish Encryption và Menu ngữ cảnh trong Explorer . Folder Lock là một phần mềm bảo mật file được download nhiều nhất trong thị trường hiện nay.Folder Lock tạo ra kho mã hóa gọi là ‘Lockers’.. Bạn có thể giữ nhiều các tập tin và thư mục của bạn trong Locker và mật khẩu bảo vệ nó với một nhấp chuột duy nhất. Bạn có thể chuyển giao, an toàn và sao lưu các ‘Lockers’. Bạn có thể giữ chúng trong USB Driver, CD / DVD, và máy tính xách tay hoặc chuyển chúng qua email hoặc tải lên.Folder Lock là phần mềm bảo vệ dữ liệu có khả năng cài đặt password ẩn hoặc mã hoá bất kì dữ liệu, thư mục, phân vùng trong máy chỉ trong vài giây. Những file được Folder Lock bảo vệ sẽ được ẩn đi (hidden), và nếu bị tìm ra cũng không thể xoá, không thể truy cập nếu không phải “chính chủ nhân”. Dữ liệu nhạy cảm của bạn sẽ được giấu kín trước con mắt tò mò của bất cứ ai.

Folder Lock bảo vệ được dữ liệu của bạn ngay cả khi file đó đã bị copy sang máy tính khác, mà không cần phần mềm được cài đặt trên máy tính đó, và tất nhiên file không thể mở được . Nó khóa file trong Windows, DOS và thậm chí cả Safe Modes. Những tùy chọn thêm bao gồm Stealth Mode, HackerAttempt Monitoring, các tập tin Shred,Folder Lock cung cấp đầy đủ tính di động bằng cách cung cấp mật khẩu bảo vệ máy tính độc lập của các tập tin và thư mục của bạn. Tạo một Locker di động trong ổ USB hoặc thẻ nhớ Memory Stick và Folder Lock cũng sẽ tạo ra một autoplay thực thi trong ổ đĩa USB của bạn.Folder Lock tương thích tất cả 32-bit và 64-bit Windows 8 ,Windows 7, Windows Vista, Windows XP, Windows 2008, Windows 2003 Server và Windows 2000 và hoạt động trên tất cả các loại định dạng đĩa như FAT16, FAT32, NTFSFolder Lock 7.2.6 Final | 9.09 MBthegioitinhoc.vnFolder Lock là phần mềm bảo mật file nhanh, có thể bảo vệ bằng password , khóa , ẩn, mã hóa mọi số lượng file, thư mục, ổ đĩa , hình ảnh, và các văn bản chỉ trong vài giây . Tập tin bị khóa , unrenamable , không thể di chuyển , ẩn, và không thể tiếp cận . Bạn có thể khóa , hoặc mã hóa tùy thuộc vào tốc độ và bảo mật. Folder Lock là hoàn toàn di động , vì vậy bạn có thể bảo vệ các tập tin của bạn trên ổ đĩa flash USB , đĩa , CD -RW , máy tính xách tay , và ổ đĩa cứng , và nó không yêu cầu cài đặt trên máy tính khác . Folder Lock khóa file trong Windows, DOS , và chế độ Safe Mode , ngay cả khi bạn thay đổi hệ điều hành hoặc khởi động từ một đĩa . Folder Lock không cho phép bạn xóa thư mục chương trình riêng của mình , và nó không thể được gỡ bỏ mà không có mật khẩu chính xác . Các tùy chọn thêm bao gồm Stealth Mode , Hacker Attempt Monitoring , các tập tin Shred , tự động khóa , tự động tắt máy tính , khóa máy tính của bạn , Xóa các PC , 256-bit Blowfish Encryption và Menu ngữ cảnh trong Explorer.Các tính năngMã hóa nhanh nhất : Với Folder Lock , bây giờ bạn có thể mã hóa các tập tin của bạn nhanh hơn bao giờ hết. Chương trình tạo tủ khóa , mà không chiếm nhiều không gian và phát triển như bạn biến các tập tin trong đó.An toàn sao lưu: Folder Lock 7 cho phép bạn tùy chọn sao lưu tất cả các tập tin và thư mục mà bạn giữ trong tủ khóa mã hóa của bạn tự động trong khi bạn tiếp tục sửa đổi hoặc truy cập vào các tập tin được mã hóa của bạn.

Tập tin vẫn còn được mã hóa ở cả hai đầu .An ninh: Người dùng có thể đạt được sự thật bảo mật di động, bảo mật mật khẩu mức độ ứng dụng , kích hoạt tùy chọn ẩn, xóa sạch tập tin ,, lịch sử sạch , tự động bảo vệ các ứng dụng và tất cả các tập tin của mình , sử dụng bàn phím ảo để gõ mật khẩu để ngăn chặn khai thác gỗ quan trọng của bất kỳ loại và có thể ngăn chặn hack và nỗ lực mật khẩu không chính xác.Dễ sử dụng: Folder Lock 7 được đánh giá cao giao diện người dùng đồ họa NewSoftware . Hiện có người sử dụng Folder Lock sẽ được ngay lập tức sản xuất : đó là giao diện điều khiển tuyệt vời. Người dùng mới sẽ tìm thấy Folder Lock 7 khá dễ dàng để cấu hình và sử dụng . Ngay cả người mới tương đối có thể sử dụng tất cả các tính năng của sản phẩm mà không đi qua tất cả các thuật ngữ và làm thế nào TOS .

[SystemUI MOD] [UPDATED] 24 Lockscreen Anima… | Samsung Galaxy Note 3 | XDA Forums .


*i*m*g*My device details:Note 3 N9005, rooted, Stock Recovery (Knox 0x0),PDA: N9005XXUGBOB6CSC: N9005XEOGBOA4Region: XEO (Poland)Thanks to @ dr.ketan for UPSM, He is the one ported UPSM to N9005 Lollipop.Thanks to AryaMod Team and @ kmokhtar79 for services.jar used in UPSM and Emergency Mod.Sorry if I missed anybody else. Please let me know, so that I can include it.This Mod is working fine on Omega ROM for Note 3 N9005 Lollipop. Confirmed by @ Schrotty35 here.Changes: Enabled 14 Swipe unlock effect (None, Watercolour, Popping colors, Ripple, Abstract tiles, Geometric mosaic, Light effect, Skipping stone, Ink in water, Brilliant cut, Brilliant ring, Zoom Panning, Spring, Summer, Autumn, Winter, Seasonal) [Zoom Panning effect is removed] under Lockscreen Settings. Enabled 4 Seasonal Charging Animation effect with preview on Lockscreen (None, Summer, Winter, Autumn, Spring, Seasonal) under Lockscreen Settings. Enabled 4 Pattern Unlock effect with preview (Classic, Halftone, Morphing, Multicolour) under Lockscreen Settings. Enabled Toolbox under Notification panel Settings. [REMOVED] Enabled Side Key Panel under One Hand Operations Settings. Enabled Emergency Mode and GeoNews under Safety Assistance Settings. Enabled Lockscreen flashlight under Display Settings. Enabled UPSM, Greyscale mode and Restrict background data under Power Saving mode. [Restrict background data is removed] Enabled Call/Message Blocking under Device header Settings. Enabled Application permissions in General Section header. Enabled Fast charging checkbox under Battery. Added Network Speed Indicator under Display Settings. Transparent Recent apps background. In order to get Toolbox, SideKeyPanel, UPSM, TouchSensitivity, Adaptive Display in notification panel QuickToggles. Please edit notification_panel_acive_app_list_for_reset of Settings Storage com.android.providers.settings (settings.db -- system) using SQLite editor:Add following without any white space:ToolboxUltraPowerSavingTouchSensitivitySideKey AdaptiveDisplayPlease follow this thread for more details on Toolbox and SideKeyPanel. Link Toolbox_SideKeyPanelThanks to @ thereassaad.Please, Please take backup before replacing files.To enable Side Key Panel:Download the attached SideKeyPanel_Note3.zip file, extract it and then copy it to device using root explorer.Replace/Copy the following files: (Do take a backup first) EasySideKey.apk inside system/app/EasySideKeyPanel. com.sec.feature.floating_side_softkey.xml inside system/etc/permissionsTo enable UPSM and Emergency mode:Download the attached UPSM.zip file, extract it and then copy it to device using root explorer.Replace/Copy the following files: (Do take a backup first) EmergencyLauncher.apk inside system/app/EmergencyLauncher EmergencyModeService.apk inside system/app/EmergencyModeService EmergencyProvider.apk inside system/app/EmergencyProvider mixer_paths.xml inside system/etc services.jar inside system/frameworkTo enable Toolbox, Popping colors in Music app, Priority senders in messages:Download the attached Toolbox_PriorityMessage_poppingColorInMusic.zip file, extract it and then copy it to device using root explorer.Replace/Copy the following files: (Do take a backup first) floating_feature.xml in system/etcTo enable the unlock effects [Swipe, Pattern, Charging]: Download SecSettings_N9005_BOB6.zip and SystemUI_N9005_BOB6.zip Copy paste the SecSettings.apk into syatem/priv-app/SecSettings and set the correct permission. Copy-paste all the .ogg files of Unlock Effect in to the folder system/media/audio/ui and set the correct permissions. Finally Copy paste the SystemUI.apk into syatem/priv-app/SystemUI and set the correct permissions.Restart the device.Known Bugs:1. Settings FC when clicked on Toolbox edit button.Workaround for it: Press and hold the Toolbox app icon and then drag it to top left for editing.2. Few widgets like Transparent weather, Active Apps and GeoNews will disappear when you disable UPSM.

FIXED - Use newly attached UPSM_N9005.zip Thank you so much @ Jiermon.3. In UPSM pleaee access setting from Quick panel [Notification Panel] else cause FC.Please do set the Correct permissions for all folders: rwxr-xr-x (0755)and for apk files set the permisisons: rw-r--r-- (0644)SecSettings.apk for BOB6 N9005 Download LinkGoogle Docs: HereGoogle Drive: HereSecSettings.apk for BOB6 N9005 with Network Speed IndicatorGoogle Docs: HereGoogle Drive: HereSecSettings.apk for BOB6 N9005 New [08/04/2015]Google Docs: HereGoogle Drive: HereGeoNews, MontBlac content, SnapBizCard and OpticalReader for Note 3 N900/N9005 Download LinkNote 3 N9005 lollipop Camera Mod Here*****************************************Consider hitting Thanks Button, if you liked my work.Thank You.

bookmark all open tabs? | Firefox Support Forum | Mozilla Support .


*i*m*g*Some menu entries in the main menu bar are hidden if you use the mouse and only appear if you use the keyboard to open the menu.You can see the difference if you use Alt+F to open the File menu or other menus like the Edit menu (Alt+E) and Bookmarks menu (Alt+B) and compare that to what you see if you use the mouse to open the menu after you have made the menu bar visible by tapping Alt or by pressing F10.Bookmark All Tabs (Shift+Ctrl+D) no longer shows in the Bookmarks menu unless you open the Bookmarks menu via the keyboard (Alt + B).Bookmark All Tabs can be accessed via the right-click context menu of a tab on the tab bar.Bookmark This Page can be accessed via the right-click context menu of that browser page.Read this answer in context 12Some menu entries in the main menu bar are hidden if you use the mouse and only appear if you use the keyboard to open the menu.You can see the difference if you use Alt+F to open the File menu or other menus like the Edit menu (Alt+E) and Bookmarks menu (Alt+B) and compare that to what you see if you use the mouse to open the menu after you have made the menu bar visible by tapping Alt or by pressing F10.Bookmark All Tabs (Shift+Ctrl+D) no longer shows in the Bookmarks menu unless you open the Bookmarks menu via the keyboard (Alt + B).Bookmark All Tabs can be accessed via the right-click context menu of a tab on the tab bar.Bookmark This Page can be accessed via the right-click context menu of that browser page.Some menu entries in the main menu bar are hidden if you use the mouse and only appear if you use the keyboard to open the me . ...
You can see the difference if you use Alt+F to open the File menu or other menus like the Edit menu (Alt+E) and Bookmarks menu (Alt+B) and compare that to what you see if you use the mouse to open the menu after you have made the menu bar visible by tapping Alt or by pressing F10.* Bookmark All Tabs (Shift+Ctrl+D) no longer shows in the Bookmarks menu unless you open the Bookmarks menu via the keyboard (Alt + B).* Bookmark All Tabs can be accessed via the right-click context menu of a tab on the tab bar.* Bookmark This Page can be accessed via the right-click context menu of that browser page.[coatli: please keep it to one question in one thread. that's over 2,000 readers who've had to read and skip your diversion. users helping users.]It's now July '14 and vn. 30 is extant, and the difference manifested when the menu is invoked with the mouse or with a hot-key still obtains.I suggest that this newly introduced feature breaks all sorts of rules in the usage guidelines for our chosen environment - Windows. (Microsoft keeps a formal set.)I suggest that it is nonsensical, illogical, and detrimental to Firefox's reputation as a worthy browser.Do the design managers in the Mozilla camp read these posts?I say it's well beyond time for differences between click and key features to be eliminated.Any software engineers listening...PhredE11th July, 2014[coatli: please keep it to one question in one thread. that's over 2,000 readers who've had to read and skip your diversion. users helping users.]It's now July '14 and vn. 30 is extant, and the difference manifested when the menu is invoked with the mouse or with a hot-key still obtains.I suggest that this newly introduced feature breaks all sorts of rules in the usage guidelines for our chosen environment - Windows. (Microsoft keeps a formal set.)I suggest that it is nonsensical, illogical, and detrimental to Firefox's reputation as a worthy browser.Do the design managers in the Mozilla camp read these posts?I say it's well beyond time for differences between click and key features to be eliminated.Any software engineers listening...PhredE11th July, 2014Add code to the userChrome.css file below the default @namespace line.http://kb.mozillazine.org/userChrome.css @namespace url( /* only needed once *//* Always show menu entries with class=show-only-for-keyboard */#navigator-toolbox menuitem[class=show-only-for-keyboard]:not([hidden=true]){ display:-moz-box !important }The customization files userChrome.css (user interface) and userContent.css (websites) are located in the chrome folder in the Firefox profile folder.http://kb.mozillazine.org/Editing_configurationYou can use this button to go to the currently used Firefox profile folder:Help Troubleshooting Information Profile Directory: Show Folder (Linux: Open Directory Mac: Show in Finder)Create the chrome folder (lowercase) in the .default profile folder if this folder doesn't existUse a plain text editor like Notepad to create a (new) userChrome.css file in this folder (the names are case sensitive)Paste the code in the userChrome.css file in the editor window and make sure that the userChrome.css file starts with the default @namespace lineMake sure that you select All files and not Text files when you save the file via Save file as in the text editor as userChrome.css. Otherwise Windows may add a hidden .txt file extension and you end up with a not working userChrome.css.txt file

[design help wanted] the Awesome Community Icon Theme!•KDE Community Forums .


*i*m*g*Yes it sounds like a badly translated Japanese Manga Serial but its a great thing. There's been a lot of talk about using the Awesome Font theme to create a new community starter pack for monochrome icons. This could then be given an accessible spot in a resource catalog for other Open Source designers to use, it can be constructed, deconstructed and reshaped to fit new design language and would form a great starting point for future Icon Themes as well as provide dev's with a nice common library of icons to be used in apps.Whats not to love!?Now Kdeuserk pointed me to this resource: ... nt-awesome where the font has been remade into Svg's and I think that starting there we can look at what icons are needed, what are missing and more importantly decide what is the design goals of the icon theme visually?So what do we need in terms of new icons that isn't covered already? Who is up for some icon sketching?I would like to help figure out what we still need. So I made a list of all needed icons in the oxygen theme. Now we can start matching Font Awesome icons to our needs.Code: Select all ACTIONSaccount_offline_overlayacrobatadd_ingredientaddress-book-newalign-horizontal-centeralign-horizontal-left-outalign-horizontal-leftalign-horizontal-right-outalign-horizontal-rightalign-vertical-bottom-outalign-vertical-bottomalign-vertical-centeralign-vertical-top-outalign-vertical-topapplication-exitappointment-newarchive-extractarchive-insert-directoryarchive-insertarchive-removearrow-down-doublearrow-downarrow-left-doublearrow-leftarrow-right-doublearrow-rightarrow-up-doublearrow-upauthorsbabelfishbookmark-new-listbookmark-newbookmark-toolbarbookmarks-organizecall-startcall-stopcategoriescharacter-setcheckboxchronometercode-blockcode-classcode-contextcode-functioncode-typedefcode-variablecolor-picker-blackcolor-picker-greycolor-picker-whitecolor-pickerconfigure-shortcutsconfigure-toolbarsconfigurecontact-newcontact_away_overlaycontact_busy_overlaycontact_food_overlaycontact_freeforchat_overlaycontact_invisible_overlaycontact_phone_overlaycontact_xa_overlaycssvalidatorcurve-connectordashboard-showdebug-execute-from-cursordebug-execute-to-cursordebug-run-cursordebug-rundebug-step-instructiondebug-step-into-instructiondebug-step-intodebug-step-outdebug-step-overdialog-canceldialog-closedialog-ok-applydialog-okdietdistribute-horizontal-centerdistribute-horizontal-equaldistribute-horizontal-leftdistribute-horizontal-margindistribute-horizontal-pagedistribute-horizontal-rightdistribute-horizontal-xdistribute-vertical-bottomdistribute-vertical-centerdistribute-vertical-equaldistribute-vertical-margindistribute-vertical-pagedistribute-vertical-topdistribute-vertical-ydocument-closedocument-decryptdocument-edit-decrypt-verifydocument-edit-decryptdocument-edit-encryptdocument-edit-sign-encryptdocument-edit-signdocument-edit-verifydocument-editdocument-encryptdocument-export-tabledocument-exportdocument-importdocument-newdocument-open-datadocument-open-folderdocument-open-recentdocument-open-remotedocument-opendocument-preview-archivedocument-previewdocument-print-directdocument-print-framedocument-print-previewdocument-printdocument-propertiesdocument-revertdocument-save-alldocument-save-asdocument-savedocument-signdocument-swapdocumentationdocumentinfodownload-laterdownloaddraw-arrow-backdraw-arrow-downdraw-arrow-forwarddraw-arrow-updraw-bezier-curvesdraw-brushdraw-circledraw-crossdraw-donutdraw-ellipsedraw-eraserdraw-freehanddraw-halfcircle1draw-halfcircle2draw-halfcircle3draw-halfcircle4draw-linedraw-pathdraw-polygondraw-polylinedraw-rectangledraw-spiraldraw-square-inverted-cornersdraw-stardraw-textdraw-triangledraw-triangle1draw-triangle2draw-triangle3draw-triangle4edit-bombedit-clear-historyedit-clear-listedit-clear-locationbar-ltredit-clear-locationbar-rtledit-clearedit-copyedit-cutedit-delete-pageedit-delete-shrededit-deleteedit-find-mailedit-find-projectedit-find-replaceedit-find-useredit-findedit-guidesedit-image-face-addedit-image-face-detectedit-image-face-recognizeedit-image-face-showedit-linkedit-nodeedit-pasteedit-redoedit-renameedit-select-alledit-selectedit-table-cell-mergeedit-table-cell-splitedit-table-delete-columnedit-table-delete-rowedit-table-insert-column-leftedit-table-insert-column-rightedit-table-insert-row-aboveedit-table-insert-row-belowedit-table-insert-row-underedit-text-frame-updateedit-undoemoticonfeed-subscribefill-colorflag-blackflag-blueflag-greenflag-redflag-yellowflagfolder-newfolder-syncforkformat-add-nodeformat-break-nodeformat-connect-nodeformat-disconnect-nodeformat-fill-colorformat-font-size-lessformat-font-size-moreformat-indent-lessformat-indent-moreformat-join-nodeformat-justify-centerformat-justify-fillformat-justify-leftformat-justify-rightformat-line-spacing-doubleformat-line-spacing-normalformat-line-spacing-tripleformat-list-orderedformat-list-unorderedformat-remove-nodeformat-stroke-colorformat-text-boldformat-text-colorformat-text-direction-ltrformat-text-direction-rtlformat-text-italicformat-text-strikethroughformat-text-subscriptformat-text-superscriptformat-text-underlinegames-achievementsgames-config-backgroundgames-config-boardgames-config-customgames-config-optionsgames-config-themegames-config-tilesgames-difficultgames-endturngames-highscoresgames-hintgames-solveget-hot-new-stuffgo-bottomgo-down-searchgo-downgo-first-view-pagego-first-viewgo-firstgo-homego-jump-declarationgo-jump-definitiongo-jump-locationbargo-jump-todaygo-jumpgo-last-view-pagego-last-viewgo-lastgo-next-contextgo-next-usego-next-view-pagego-next-viewgo-nextgo-parent-foldergo-previous-contextgo-previous-usego-previous-view-pagego-previous-viewgo-previousgo-topgo-up-searchgo-uphelp-abouthelp-contentshelp-contextualhelp-donatehelp-feedbackhelp-hinthtmlvalidatorim-aimim-ban-kick-userim-ban-userim-facebookim-icqim-identi.caim-invisible-userim-jabberim-kick-userim-msnim-qqim-skypeim-status-message-editim-twitterim-user-awayim-user-busyim-user-offlineim-userim-yahooimagegalleryingredientsinsert-buttoninsert-horizontal-ruleinsert-imageinsert-linkinsert-tableinsert-text-frameinsert-textirc-close-channelirc-join-channelirc-operatorirc-remove-operatorirc-unvoiceirc-voicekey-enterkmix-masterlastmoveslayer-visible-offlayer-visible-onlegalmoveslines-connectorlist-add-fontlist-add-userlist-addlist-remove-userlist-removelist-resource-addmail-encrypted-fullmail-encrypted-partmail-encryptedmail-flagmail-forwardmail-forwarded-repliedmail-forwardedmail-invitationmail-mark-importantmail-mark-junkmail-mark-notjunkmail-mark-readmail-mark-unread-newmail-mark-unreadmail-meeting-request-replymail-message-new-listmail-message-newmail-queuemail-receivemail-repliedmail-reply-allmail-reply-custom-allmail-reply-custommail-reply-listmail-reply-sendermail-sendmail-signature-unknownmail-signed-fullmail-signed-fullymail-signed-partmail-signed-verifiedmail-signedmail-taggedmeasuremedia-ejectmedia-playback-pausemedia-playback-startmedia-playback-stopmedia-recordmedia-seek-backwardmedia-seek-forwardmedia-skip-backwardmedia-skip-forwardmeeting-attending-tentativemeeting-attendingmeeting-participant-no-responsemeeting-participant-request-responsemetacontact_unknownmethodsmilestonenetwork-connectnetwork-disconnectnews-subscribenews-unsubscribeobject-align-horizontal-center-calligraobject-align-horizontal-left-calligraobject-align-horizontal-right-calligraobject-align-vertical-bottom-calligraobject-align-vertical-bottom-top-calligraobject-align-vertical-center-calligraobject-align-vertical-top-calligraobject-flip-horizontalobject-flip-verticalobject-group-calligraobject-groupobject-order-back-calligraobject-order-backobject-order-front-calligraobject-order-frontobject-order-lower-calligraobject-order-lowerobject-order-raise-calligraobject-order-raiseobject-rotate-leftobject-rotate-rightobject-ungroup-calligraobject-ungroupoffice-chart-area-focus-peak-nodeoffice-chart-area-percentageoffice-chart-area-stackedoffice-chart-areaoffice-chart-bar-percentageoffice-chart-bar-stackedoffice-chart-baroffice-chart-line-percentageoffice-chart-line-stackedoffice-chart-lineoffice-chart-pieoffice-chart-polar-stackedoffice-chart-polaroffice-chart-ringoffice-chart-scatterpage-2sidespage-3sidespage-4sidespage-simplepage-zoompdf-annotationsplayer-timeplayer-volume-mutedplayer-volumepreferences-activitiespreflight-verifierprocess-stopproject-development-close-allproject-development-closeproject-development-new-templateproject-developmentproject-openpropertiesquickopen-classquickopen-filequickopen-functionquickopenratingresource-calendar-child-insertresource-calendar-childresource-calendar-insertresource-group-newresource-grouprollrun-build-cleanrun-build-configurerun-build-filerun-build-install-rootrun-build-installrun-build-prunerun-buildselect-rectangularservicesshow-menusmallclocksnap-extensionsnap-guidelinesnap-intersectionsnap-nodesnap-orthogonalspeakerstandard-connectorstatus_unknownstatus_unknown_overlaystory-editorstraight-connectorstroke-cap-buttstroke-cap-roundstroke-cap-squarestroke-join-bevelstroke-join-miterstroke-join-roundsvn-commitsvn-updatesystem-lock-screensystem-log-outsystem-rebootsystem-runsystem-searchsystem-shutdownsystem-suspend-hibernatesystem-suspendsystem-switch-usertab-close-othertab-closetab-detachtab-duplicatetab-new-backgroundtab-newtabletext-fieldtext-frame-linktext-frame-unlinktext-speaktool-animatortools-check-spellingtools-media-optical-burn-imagetools-media-optical-burntools-media-optical-copytools-media-optical-erasetools-media-optical-formattools-report-bugtools-rip-audio-cdtools-rip-video-cdtools-rip-video-dvdtools-wizardtransform-crop-and-resizetransform-croptransform-movetransform-rotatetransform-scaletransform-shear-downtransform-shear-lefttransform-shear-righttransform-shear-uptrash-emptyunitsupindicatoruser-group-deleteuser-group-newuser-group-propertiesuser-propertiesvalidatorsview-bankview-barcode-addview-barcodeview-calendar-agendaview-calendar-birthdayview-calendar-dayview-calendar-holidayview-calendar-journalview-calendar-listview-calendar-monthview-calendar-special-occasionview-calendar-tasksview-calendar-time-spentview-calendar-timelineview-calendar-upcoming-daysview-calendar-upcoming-eventsview-calendar-wedding-anniversaryview-calendar-weekview-calendar-whatsnextview-calendar-workweekview-calendarview-certificate-addview-certificate-export-secretview-certificate-export-serverview-certificate-exportview-certificate-importview-certificate-server-configureview-certificate-signview-certificateview-chooseview-closeview-conversation-balloonview-file-columnsview-filterview-financial-forecastview-form-actionview-form-tableview-formview-fullscreenview-gridview-groupview-historyview-ldap-resourceview-left-closeview-list-detailsview-list-iconsview-list-textview-list-treeview-media-artistview-media-equalizerview-media-lyricsview-media-playlistview-media-visualizationview-multiple-objectsview-object-histogram-linearview-object-histogram-logarithmicview-pim-calendarview-pim-contactsview-pim-journalview-pim-mailview-pim-newsview-pim-notesview-pim-summaryview-pim-tasks-pendingview-pim-tasksview-presentationview-previewview-process-all-treeview-process-allview-process-ownview-process-systemview-process-treeview-process-usersview-refreshview-resource-calendarview-restoreview-right-closeview-right-newview-sidetreeview-sort-ascendingview-sort-descendingview-split-left-rightview-split-top-bottomview-statisticsview-task-addview-task-child-addview-task-childview-taskview-time-schedule-baselined-addview-time-schedule-baselined-removeview-time-schedule-baselinedview-time-schedule-calculusview-time-schedule-child-insertview-time-schedule-editview-time-schedule-insertview-time-scheduleview-user-offline-kopeteview-web-browser-dom-treevoicecallwebarchiverwebcamreceivewebcamsendwindow-closewindow-duplicatewindow-newzoom-1-to-2zoom-2-to-1zoom-drawzoom-fit-bestzoom-fit-heightzoom-fit-widthzoom-inzoom-nextzoom-originalzoom-outzoom-previouszoom-selectANIMATIONprocess-idle-kdeprocess-working-kdeAPPSCharmaccessories-calculatoraccessories-character-mapaccessories-dictionaryaccessories-text-editoracroreadakonadiakregatorbasketclockcomputerdaemondigikamesdfontforgegraphics-viewer-documenthelp-browserhwinfoinkscapeinternet-mailinternet-telephonyinternet-web-browserjavak3bkaffeinekalarm-activekbloggerkbruchkbugbusterkchartkcmdfkcmkwmkcolorchooserkde-windowskdekdeappkdevelopkdfkernelkfontviewkformulakgpgkigkiviokjournalklipperkmagkmplayerknetattachknewstickerknoteskolfkollisionkonquerorkontactkonversationkorgackplatokpresenterkrdckrfbksnapshotksnifferkspreadksudokuksysguarddkthesaurusktipktorrentkuickshowkverboskwalletmanagerkwinkwordlokalizemultimedia-volume-controlnepomukoffice-address-bookoffice-calendaroktetaoxygenpartitionmanagerpicmiplasmaplasmagikpreferences-contact-listpreferences-desktop-accessibilitypreferences-desktop-colorpreferences-desktop-cryptographypreferences-desktop-default-applicationspreferences-desktop-display-colorpreferences-desktop-displaypreferences-desktop-filetype-associationpreferences-desktop-fontpreferences-desktop-gamingpreferences-desktop-iconspreferences-desktop-keyboardpreferences-desktop-launch-feedbackpreferences-desktop-localepreferences-desktop-mousepreferences-desktop-notification-bellpreferences-desktop-notificationpreferences-desktop-printerpreferences-desktop-screensaverpreferences-desktop-soundpreferences-desktop-text-to-speechpreferences-desktop-themepreferences-desktop-user-passwordpreferences-desktop-userpreferences-desktop-wallpaperpreferences-kcalc-constantspreferences-plugin-scriptpreferences-pluginpreferences-system-bluetooth-inactivepreferences-system-bluetoothpreferences-system-loginpreferences-system-network-sharingpreferences-system-performancepreferences-system-power-managementpreferences-system-session-servicespreferences-system-timepreferences-system-windows-actionspreferences-system-windows-movepreferences-system-windowspreferences-web-browser-adblockpreferences-web-browser-cachepreferences-web-browser-cookiespreferences-web-browser-identificationpreferences-web-browser-shortcutspreferences-web-browser-stylesheetsqelectrotechquasselrawconverterrunningscribussemnshellshowfotostepstrigisystem-file-managersystem-software-updatesystem-userstaguatelepathy-kdeunknownapputilities-desktop-extrautilities-file-archiverutilities-log-viewerutilities-system-monitorutilities-terminalwaitingwinexorgyakuakeCATEGORIESapplications-accessoriesapplications-development-translationapplications-development-webapplications-developmentapplications-education-languageapplications-education-mathematicsapplications-education-miscellaneousapplications-education-preschoolapplications-education-schoolapplications-education-scienceapplications-education-universityapplications-educationapplications-engineeringapplications-gamesapplications-graphicsapplications-internetapplications-multimediaapplications-officeapplications-otherapplications-scienceapplications-systemapplications-toysapplications-utilitiespreferences-desktop-peripheralspreferences-desktop-personalpreferences-desktoppreferences-otherpreferences-system-networkpreferences-systemsystem-helpDEVICESaudio-cardaudio-headphonesaudio-headsetaudio-input-lineaudio-input-microphonebatterycamera-photocamera-webcomputer-laptopcomputercpudrive-harddiskdrive-opticaldrive-removable-media-usb-pendrivedrive-removable-media-usbdrive-removable-mediainput-gaminginput-keyboardinput-mouseinput-tabletmedia-flash-memory-stickmedia-flash-sd-mmcmedia-flash-smart-mediamedia-flashmedia-floppymedia-optical-audiomedia-optical-blu-raymedia-optical-datamedia-optical-dvdmedia-optical-mixed-cdmedia-optical-recordablemedia-optical-videomedia-opticalmedia-tapemodemmultimedia-player-apple-ipodmultimedia-playernetwork-wirednetwork-wirelesspdaphone-openmoko-freerunnerphoneprinterscannersecure-cardsmartphonetabletvideo-displayvideo-projectorvideo-televisionEMBLEMSemblem-encrypted-lockedemblem-encrypted-unlockedemblem-favoriteemblem-importantemblem-lockedemblem-mountedemblem-newemblem-symbolic-linkemblem-unlockedemblem-unmountedimage-has-versions-openimage-has-versionsimage-stack-openimage-stackvcs-addedvcs-conflictingvcs-locally-modified-unstagedvcs-locally-modifiedvcs-normalvcs-removedvcs-update-requiredEMOTESface-angelface-embarrassedface-kissface-laughface-plainface-raspberryface-sadface-smile-bigface-smileface-surpriseface-uncertainface-winkMIMETYPESapplication-epub+zipapplication-illustratorapplication-javascriptapplication-msword-templateapplication-mswordapplication-octet-streamapplication-pdfapplication-pgp-encryptedapplication-pgp-keysapplication-pgp-signatureapplication-pkcs7-mimeapplication-pkcs7-signatureapplication-postscriptapplication-relaxngapplication-rss+xmlapplication-rtfapplication-sxwapplication-vnd-google-earth-kmlapplication-vnd.iccprofileapplication-vnd.ms-accessapplication-vnd.ms-excelapplication-vnd.ms-powerpointapplication-vnd.oasis.opendocument.chartapplication-vnd.oasis.opendocument.databaseapplication-vnd.oasis.opendocument.formula-templateapplication-vnd.oasis.opendocument.formulaapplication-vnd.oasis.opendocument.graphicsapplication-vnd.oasis.opendocument.imageapplication-vnd.oasis.opendocument.presentation-templateapplication-vnd.oasis.opendocument.presentationapplication-vnd.oasis.opendocument.spreadsheet-templateapplication-vnd.oasis.opendocument.spreadsheetapplication-vnd.oasis.opendocument.text-masterapplication-vnd.oasis.opendocument.text-templateapplication-vnd.oasis.opendocument.textapplication-vnd.openxmlformats-officedocument.wordprocessingml.documentapplication-vnd.rn-realmediaapplication-vnd.scribusapplication-vnd.stardivision.calcapplication-vnd.stardivision.drawapplication-vnd.stardivision.mailapplication-vnd.stardivision.mathapplication-vnd.sun.xml.calcapplication-vnd.sun.xml.calc.templateapplication-vnd.sun.xml.drawapplication-vnd.sun.xml.draw.templateapplication-vnd.sun.xml.impressapplication-vnd.sun.xml.impress.templateapplication-vnd.sun.xml.mathapplication-vnd.sun.xml.writer.globalapplication-vnd.sun.xml.writerapplication-vnd.sun.xml.writer.templateapplication-vnd.wordperfectapplication-x-7z-compressedapplication-x-abiwordapplication-x-aceapplication-x-applix-spreadsheetapplication-x-applix-wordapplication-x-arapplication-x-arcapplication-x-archiveapplication-x-arjapplication-x-awkapplication-x-bittorrentapplication-x-blenderapplication-x-bzdviapplication-x-bzip-compressed-tarapplication-x-bzipapplication-x-cd-imageapplication-x-cdaapplication-x-chmapplication-x-compressapplication-x-compressed-tarapplication-x-cpioapplication-x-cueapplication-x-debapplication-x-designerapplication-x-desktopapplication-x-egonapplication-x-executable-scriptapplication-x-executableapplication-x-font-afmapplication-x-font-bdfapplication-x-font-otfapplication-x-font-pcfapplication-x-font-snfapplication-x-font-ttfapplication-x-font-type1application-x-gnumericapplication-x-gzdviapplication-x-gzipapplication-x-gzpostscriptapplication-x-it87application-x-java-appletapplication-x-java-archiveapplication-x-javaapplication-x-javascriptapplication-x-k3bapplication-x-kcsrcapplication-x-kexi-connectiondataapplication-x-kexiproject-shortcutapplication-x-kexiproject-sqliteapplication-x-kexiproject-sqlite2application-x-kexiproject-sqlite3application-x-kformulaapplication-x-kgetlistapplication-x-kontourapplication-x-kplatoapplication-x-krecipes-backupapplication-x-krecipes-recipesapplication-x-kritaapplication-x-kvtmlapplication-x-kwordapplication-x-lhaapplication-x-lyxapplication-x-lzma-compressed-tarapplication-x-lzopapplication-x-m4application-x-marbleapplication-x-mimearchiveapplication-x-mplayer2application-x-ms-dos-executableapplication-x-mswinurlapplication-x-mswriteapplication-x-nzbapplication-x-objectapplication-x-pakapplication-x-pem-keyapplication-x-perlapplication-x-phpapplication-x-plasmaapplication-x-python-bytecodeapplication-x-qet-elementapplication-x-qet-projectapplication-x-quattroproapplication-x-rarapplication-x-rpmapplication-x-rubyapplication-x-sharedlibapplication-x-shellscriptapplication-x-shockwave-flashapplication-x-siagapplication-x-smb-serverapplication-x-smb-workgroupapplication-x-sqlite2application-x-sqlite3application-x-srtapplication-x-srtripapplication-x-subripapplication-x-tarapplication-x-tarzapplication-x-tgifapplication-x-trashapplication-x-troff-manapplication-x-tzoapplication-x-wmfapplication-x-zerosizeapplication-x-zooapplication-xhtml+xmlapplication-xmlapplication-xsdapplication-xslt+xmlapplication-zipaudio-ac3audio-midiaudio-prs.sidaudio-vn.rn-realmediaaudio-vnd.rn-realvideoaudio-x-adpcmaudio-x-aiffaudio-x-flac+oggaudio-x-flacaudio-x-genericaudio-x-monkeyaudio-x-speex+oggaudio-x-wavencryptedfonts-packageimage-svg+xml-compressedimage-svg+xmlimage-vnd.dgnimage-vnd.dwgimage-x-adobe-dngimage-x-epsimage-x-genericimage-x-vnd.trolltech.qpictureimage-x-xfiginode-directorymessage-newsmessage-partialmessage-rfc822message-x-gnu-rmailmessagepackage-x-generictext-calendartext-csstext-csvtext-directorytext-enrichedtext-htmltext-mathmltext-plaintext-rdf+xmltext-rdftext-rtftext-sgmltext-trofftext-vcalendartext-vnd.abctext-vnd.wap.wmltext-x-adasrctext-x-authorstext-x-bibtextext-x-c++hdrtext-x-c++srctext-x-changelogtext-x-chdrtext-x-cmaketext-x-copyingtext-x-csharptext-x-csrctext-x-dtdtext-x-generictext-x-haskelltext-x-hextext-x-installtext-x-javatext-x-katefilelisttext-x-ldiftext-x-lilypondtext-x-logtext-x-makefiletext-x-nfotext-x-objchdrtext-x-objcsrctext-x-pascaltext-x-patchtext-x-potext-x-pythontext-x-qmltext-x-readmetext-x-rpm-spectext-x-scripttext-x-sqltext-x-tcltext-x-textext-x-texinfotext-x-vcardtext-x-xslfotext-xmcdtext-xmlunknownuri-mmsuri-mmsturi-mmsuuri-pnmuri-rtspturi-rtspuvideo-x-genericvideo-x-mngx-kde-nsplugin-generatedx-mail-distribution-listx-media-podcastx-office-address-bookx-office-calendarx-office-contactx-office-documentx-office-presentationx-office-spreadsheetPLACESbookmarkscertificate-serverdocument-multiplefavoritesfolder-activitiesfolder-blackfolder-bluefolder-bookmarkfolder-brownfolder-cyanfolder-developmentfolder-documentsfolder-downloadsfolder-favoritesfolder-greenfolder-greyfolder-htmlfolder-image-peoplefolder-imagefolder-importantfolder-lockedfolder-networkfolder-orangefolder-printfolder-redfolder-remotefolder-soundfolder-tarfolder-tempfolder-txtfolder-videofolder-violetfolder-yellowfoldermail-folder-inboxmail-folder-outboxmail-folder-sentmail-messagenetwork-server-databasenetwork-servernetwork-workgrouprepositoryserver-databasestart-here-kdestart-hereuser-desktopuser-homeuser-identityuser-trashSPECIALfile-zoom-infile-zoom-outimage-zoom-inimage-zoom-outSTATUSappointment-recurringappointment-reminderaudio-volume-highaudio-volume-lowaudio-volume-mediumaudio-volume-mutedbattery-040battery-060battery-080battery-100battery-cautionbattery-charging-040battery-charging-060battery-charging-080battery-charging-cautionbattery-charging-lowbattery-chargingbattery-lowbattery-missingdialog-errordialog-informationdialog-passworddialog-warningfolder-openimage-loadingimage-missingmail-attachmentmail-queuedmail-readmail-repliedmail-sentmail-taggedmail-taskmail-unread-newmail-unreadmedia-playlist-repeatmedia-playlist-shufflemeeting-chairmeeting-observermeeting-organizermeeting-participant-optionalmeeting-participant-replymeeting-participantobject-lockedobject-unlockedprinter-errorprinter-printingscript-errorsecurity-highsecurity-lowsecurity-mediumtask-acceptedtask-attempttask-attentiontask-completetask-delegatetask-ongoingtask-recurringtask-rejecttask-reminderuser-away-extendeduser-awayuser-busyuser-invisibleuser-offlineuser-onlineuser-trash-fullwallet-closedwallet-openweather-clear-nightweather-clearweather-clouds-nightweather-cloudsweather-few-clouds-nightweather-few-cloudsweather-freezing-rainweather-hailweather-many-cloudsweather-mistweather-showers-dayweather-showers-nightweather-showers-scattered-dayweather-showers-scattered-nightweather-showers-scatteredweather-showersweather-snow-rainweather-snow-scattered-dayweather-snow-scattered-nightweather-snow-scatteredweather-snowweather-stormwindow-suppressedWe would need a central place where existing icons can be seen, along with their name. It will be difficult to achieve this in this forum, just imagine a preview under each name in the list. I am not sure the forum will handle that.Any suggestions regarding an online resource that would allow collaborative icon development?It should be list of icons along with a chance to upload icons by different users there and the best icon could be chosen, or less good ones can be improved.Meaning this should look like this:Icon name: align-horizontal-centerSuggestions:by Picol Vectorby Cole BemisDiscussion: The horizontal character is not shown. I would include horizontal arrows to make this clear.Hahaha! Ok Verbalshadow, well done on the list! It's just what we needed (plus maybe the [code]-tags)Right! Ok so next order of business, I'm setting up a Google Document with that list and then we check them off, one by one and see which are already done!Here's the Google Document: ... sp=sharingIt has, as you can see Done (Yes/No), Being Done By Who?, (Fill in if you're working on this icon with your email, or write Font if you find it in the Icon link above), Link to SVG (a hotlink to the SVG either in the font or where ever you put it when done)I've started looking through the icons now. Everyone join in and we can get this sorted fastIvan: do you have any pointers or something like a place to put it if you've already done a bit of the work?Kdeuserk: well true... it's not optimal. Hmmm lets start with this so we have something to work on and then we can migrate onward as the work changes? What do you say?I added a column saying Duplicate (yes write yes if the icon has been used before on another area).If the subject that needs an icon is a duplicate Write Dublicate instead of Y in the first column and a link to the icon as usual.If you have an idea for an Icon - talk about it in this thread BUT write your name in the Being worked on by column - and use your Forum handle. If there is already one there, write your name after that and PM that user here and post your suggestion here in the forums. When the matter is settled we add the icon being used.

  • Version History Old versions of Folder Lock Current...

    Datasheet of the download for Folder Lock Plus by NewSoftwares. Plus with a star rating, 6 screenshots along with a virus/malware test and a free download link. It may also be found on other sites such as cnet download.com or Softpedia.

  • Guide to Symbian Data Recovery Backup: How to Recover...

    21 Nov 2011 While PCs have a recycle bin, Symbian-based mobile phones rarely For example, there could be about five hundred photographs in a folder containing the mobile content. . Most Symbian devices also provide a lock code, which can be set to on Your Symbian Phone · Best Themes for the Nokia 5130 

  • Latest Version Of Facebook App Download For Nokia C5 05...

    Free Download APK Android Apps, Games, Live Wallpapers, Widgets, Themes High Speed! Latest Version Of Facebook App Download For Nokia C5 05 Plus For N206, Free Nokia 2690 Rnex Ring Tone Mobile 9, 26 January Cid Dowload, Es File Explorer Free Downloads For Android 4.2.2/phoneky, Folder Lock 

  • DOWNLOAD RED ALERT 3 FULL VN-ZOOM .

    20 Sep 2015 Operating system: Windows XP/Vista/7/8 buttons (Lock Files download red alert 3 full vn-zoom Lock Folders), and the files or folders will be 

  • Profile of deep170 - Kickass Torrents .

    look at the instructions for windows 7 because the folder is a bit different for windows 7 than windows xp and I have the same problem with Folder Lock 7.2.6.

Download
загрузка...